KEGG   Saccharomyces cerevisiae (budding yeast): YMR109WHelp
Entry
YMR109W           CDS       T00005                                 

Gene name
MYO5
Definition
(RefSeq) myosin 5
  KO
K10356  myosin I
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YMR109W (MYO5)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YMR109W (MYO5)
   03036 Chromosome and associated proteins [BR:sce03036]
    YMR109W (MYO5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sce04812]
    YMR109W (MYO5)
   04147 Exosome [BR:sce04147]
    YMR109W (MYO5)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YMR109W (MYO5)
Membrane trafficking [BR:sce04131]
 Endocytosis
  Phagocytosis
   Others
    YMR109W (MYO5)
 Others
  Actin-binding proteins
   Myosins
    YMR109W (MYO5)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Chromatin remodeling factors
   B-WICH complex
    YMR109W (MYO5)
Cytoskeleton proteins [BR:sce04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     YMR109W (MYO5)
Exosome [BR:sce04147]
 Exosomal proteins
  Proteins found in most exosomes
   YMR109W (MYO5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Myosin_head Myosin_TH1 SH3_1 SH3_9 SH3_2 RsgA_GTPase AAA_16 AAA_22 NACHT Sigma54_activat Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 855136
NCBI-ProteinID: NP_013827
SGD: S000004715
UniProt: Q04439
Structure
PDB: 

Position
XIII:486587..490246
Genome map
AA seq 1219 aa AA seqDB search
MAILKRGARKKVHQEPAKRSANIKKATFDSSKKKEVGVSDLTLLSKISDEAINENLKKRF
LNATIYTYIGHVLISVNPFRDLGIYTDAVMNEYKGKNRLEVPPHVFAIAESMYYNMKSYN
ENQCVIISGESGAGKTEAAKRIMQYIAAASSTHTESIGKIKDMVLATNPLLESFGCAKTL
RNNNSSRHGKYLEIKFNNQFEPCAGNITNYLLEKQRVVSQIKNERNFHIFYQFTKGASDA
YRQTFGVQKPEQYVYTAAAGCISAETIDDLQDYQETLKAMRVIGLGQEEQDQIFRMLAAI
LWIGNVSFIENEEGNAQVRDTSVTDFVAYLLQIDSQLLIKSLVERIMETNHGMKRGSVYH
VPLNIVQADAVRDALAKAIYNNLFDWIVSRVNKSLQAFPGAEKSIGILDIYGFEIFEHNS
FEQICINYVNEKLQQIFIQLTLKSEQETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIF
AAMNDSVATAHADSNAADQAFAQRLNLFTTNPHFDLRSNKFVIKHYAGDVTYDIDGITDK
NKDQLQKDLVELIGTTTNTFLATIFPDTVDRESKRRPPTAGDKIIKSANDLVETLSKAQP
SYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSP
HCSYAGDYTWQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDRYWHN
MAARIQRAWRRFLQRRIDAATKIQRTIRERKEGNKYEKLRDYGTKVLGGRKERRSMSLLG
YRAFMGDYLSCNESKSKGAYIKRQVSIKEKVIFSIHGEALHTKFGRSAQRLKKTFLLTPT
TLYIVGQTLVQNAMTYTQDYKIDVRNIQAVSLTNLQDDWVAIKLASSGQPDPLINTYFKT
ELITHLKRLNDKIQIKIGSAIEYQKKPGKLHSVKCQINESAPKYGDIYKSSTISVRRGNP
PNSQVHKKPRKKSSISSGYHASSSQATRRPVSIAAAQHVPTAPASRHSKKPAPPPPGMQN
KAATRRSVPNPASTLTASQSNARPSPPTAATRATPAATPAAAAMGSGRQANIPPPPPPPP
PSSKPKEPMFEAAYDFPGSGSPSELPLKKGDVIYITREEPSGWSLGKLLDGSKEGWVPTA
YMKPHSGNNNIPTPPQNRDVPKPVLNSVQHDNTSANVIPAAAQASLGDGLANALAARANK
MRLESDDEEANEDEEEDDW
NT seq 3660 nt NT seq  +upstreamnt  +downstreamnt
atggctatcttaaaaagaggagctagaaaaaaggtacatcaggagccagctaaacgctct
gcgaatatcaagaaagctacttttgattcctcgaagaagaaagaagttggtgtgtctgat
ctgacgcttctttctaaaatctccgacgaagccataaatgaaaacttgaagaagagattt
ttgaatgctacaatctacacttatataggtcatgtgttaattagtgtcaatccattccga
gacctcggaatctatactgatgctgttatgaatgaatacaaaggtaagaatagattggaa
gttccaccccatgtatttgcaattgcagagtctatgtactacaacatgaaatcatataat
gaaaatcagtgtgttattatttcaggtgaatcaggtgccggtaaaactgaagcagctaaa
agaattatgcaatatattgcggctgcttctagcacacatacggagtcaattggaaagatt
aaagacatggttttagccactaatccattgttggaatcttttggctgtgcaaagactcta
agaaataacaactcttctagacatgggaaatatctagaaataaaattcaataaccagttt
gaaccatgtgctggtaatatcacaaactatttattggagaagcagagagttgtgagtcaa
attaagaatgaaagaaatttccatatattctatcagttcacgaaaggtgcttccgatgct
tataggcaaacatttggggtccaaaaaccggaacaatatgtgtacacagctgctgcgggt
tgcatatctgctgagacaattgatgatttgcaagattatcaagagacattaaaagctatg
agagttattggtctcggtcaagaagaacaagaccaaattttcaggatgttagctgcaatt
ctttggattggtaatgtttcctttatagaaaatgaggaggggaatgcgcaagttagggac
acctcagtaaccgattttgttgcttacttgttacaaatagatagccaattgctgattaaa
tcacttgtggaaagaattatggaaaccaatcatggtatgaaaagagggtcagtgtatcat
gttccattgaatattgtccaagcagatgcggttagagatgctttggcaaaggctatttac
aataacttatttgactggattgtgagtagggttaacaaatctctgcaggcttttccaggc
gctgaaaaatccattggtattcttgatatttacggctttgaaatttttgaacataactct
tttgagcagatttgtatcaattatgttaatgaaaagttacaacaaatctttattcaattg
acattgaaatctgagcaagaaacttacgagagagaaaaaatccaatggaccccaattaaa
tactttgataacaaggttgtgtgtgatttgattgaggcaagaagaccacctggtatattt
gcagcaatgaatgattctgttgcaactgcacacgcggattcaaatgctgctgatcaggct
tttgctcagcgtttgaacttgttcacaacaaatccacattttgacttgagatctaacaag
tttgttattaagcattatgccggtgatgtcacatacgatattgacggtattacagataaa
aataaggatcaattacaaaaggatctggtagaattaattggtaccactaccaatacattt
ttagccaccattttcccggatactgtagacagagaatcaaaaagaaggccacctacagca
ggcgacaaaattataaagagtgcaaatgatttggttgaaactttatcaaaagcacaacct
tcatatatcagaacaattaaaccaaacgaaaccaaatctcctaacgattatgacgatcgg
caagttctacaccagattaagtatctaggtctgcaagaaaacgtgcgtatcagaagagca
ggttttgcatatagacaagtgtttgagaagttcgtggaaagattttatttattatctcca
cactgttcttacgctggtgactatacatggcaaggtgataccttagatgctgttaagtat
atattgcaagattcctctatcccacagcaggagtaccaattgggtgtcacaagtgttttc
atcaaaacacctgaaacattatttgctttggagcatatgagagatagatactggcacaat
atggctgccagaatccaacgtgcttggaggagatttttgcaaagaagaattgatgcggcc
actaagatccagcgcaccatcagggagaggaaggaaggtaataagtatgagaagctccgg
gattatggtacgaaggttttgggtggaagaaaagaaagaaggtctatgtccttattaggt
tacagagccttcatgggtgattatctatcatgcaacgagtccaaatcgaagggcgcttat
atcaaaagacaagtgagcattaaagagaaggtcatcttttccatacatggtgaggccttg
catacaaaatttggccgttctgcacaaagattgaaaaaaactttcctattaactccaact
acattgtacattgttggtcagactttggtccaaaatgctatgacctatactcaggattat
aaaatcgatgtgcgaaacattcaagcggttagtttaaccaatttacaggatgattgggtc
gccattaagttggctagctcaggtcaacctgaccccttaatcaacacatatttcaaaaca
gaactcataacgcatctgaaaaggcttaacgacaaaattcaaattaaaataggctcggcg
atagagtaccaaaagaaacctggaaagttgcattcagtgaaatgtcaaatcaatgaatct
gcaccaaaatatggcgacatatataaatccagtacaatatcagttcgtcgtggtaaccca
cctaattctcaagtgcacaaaaaaccgagaaaaaagagttcaatctcttcaggatatcat
gctagttcctcgcaagcaacgaggaggccagtttcgattgctgcagcccagcatgttccc
accgccccggcttctaggcattctaaaaagcctgcccctccaccaccaggaatgcagaac
aaagctgctacaagaagatctgttcctaatcctgcttccactctcactgcatcccaaagt
aatgcccgtccttctccccctactgctgccactcgtgctacacccgctgctacacccgct
gctgccgcaatgggctctggtagacaggcaaatatccctccaccacctcctccaccccca
ccctcttcaaagccaaaagaacccatgtttgaagcggcttacgattttcctggttcagga
tcaccatctgagttacctttaaagaaaggagacgtaatttacattacaagagaagaacca
agcggttggtctctcgggaaacttctggatggctctaaggaaggttgggtgccaacagct
tacatgaaaccacattccggaaataataatatccctactcctcctcaaaacagggatgtt
cctaaacccgttctgaattctgtacaacatgataacacctctgcaaacgttattccagct
gcagcccaagcaagtttgggtgatggtttggcgaatgcgcttgctgctagggccaataaa
atgagattagagagtgatgacgaggaggctaacgaagatgaagaggaagatgattggtaa

DBGET integrated database retrieval system