KEGG   Saccharomyces cerevisiae (budding yeast): YMR110CHelp
Entry
YMR110C           CDS       T00005                                 

Gene name
HFD1
Definition
(RefSeq) hexadecenal dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00010  Glycolysis / Gluconeogenesis
sce00071  Fatty acid degradation
sce00280  Valine, leucine and isoleucine degradation
sce00310  Lysine degradation
sce00330  Arginine and proline metabolism
sce00340  Histidine metabolism
sce00380  Tryptophan metabolism
sce00410  beta-Alanine metabolism
sce00561  Glycerolipid metabolism
sce00620  Pyruvate metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YMR110C (HFD1)
   00053 Ascorbate and aldarate metabolism
    YMR110C (HFD1)
   00620 Pyruvate metabolism
    YMR110C (HFD1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YMR110C (HFD1)
   00561 Glycerolipid metabolism
    YMR110C (HFD1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YMR110C (HFD1)
   00310 Lysine degradation
    YMR110C (HFD1)
   00330 Arginine and proline metabolism
    YMR110C (HFD1)
   00340 Histidine metabolism
    YMR110C (HFD1)
   00380 Tryptophan metabolism
    YMR110C (HFD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YMR110C (HFD1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     YMR110C (HFD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 855137
NCBI-ProteinID: NP_013828
SGD: S000004716
UniProt: Q04458
Position
XIII:complement(490394..491992)
Genome map
AA seq 532 aa AA seqDB search
MSNDGSKILNYTPVSKIDEIVEISRNFFFEKQLKLSHENNPRKKDLEFRQLQLKKLYYAV
KDHEEELIDAMYKDFHRNKIESVLNETTKLMNDILHLIEILPKLIKPRRVSDSSPPFMFG
KTIVEKISRGSVLIIAPFNFPLLLAFAPLAAALAAGNTIVLKPSELTPHTAVVMENLLTT
AGFPDGLIQVVQGAIDETTRLLDCGKFDLIFYTGSPRVGSIVAEKAAKSLTPCVLELGGK
SPTFITENFKASNIKIALKRIFFGAFGNSGQICVSPDYLLVHKSIYPKVIKECESVLNEF
YPSFDEQTDFTRMIHEPAYKKAVASINSTNGSKIVPSKISINSDTEDLCLVPPTIVYNIG
WDDPLMKQENFAPVLPIIEYEDLDETINKIIEEHDTPLVQYIFSDSQTEINRILTRLRSG
DCVVGDTVIHVGITDAPFGGIGTSGYGNYGGYYGFNTFSHERTIFKQPYWNDFTLFMRYP
PNSAQKEKLVRFAMERKPWFDRNGNNKWGLRQYFSLSAAVILISTIYAHCSS
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgacggctcaaaaatattgaattataccccagtgtctaaaatagatgaaata
gttgaaatctcaagaaatttcttctttgagaaacaattgaaattgtcccacgaaaataac
ccaaggaaaaaagatctagaattcaggcagttgcagttgaaaaaactctattatgccgtc
aaagatcatgaggaagaactgatcgatgctatgtacaaggactttcatcggaacaaaatt
gaatcggttctgaatgaaacgaccaaacttatgaacgatatacttcacctaattgagatt
ttaccaaaattgatcaaacctcggagagtatctgattcttctcctccatttatgtttggt
aaaacaatcgtggagaaaatatcaaggggcagtgtcttgattattgctcctttcaatttt
cccctacttttagcatttgccccattggcagcagctcttgctgcaggtaacaccattgtt
ctgaagccaagtgaactaacaccacacactgctgtagttatggaaaatttgttaaccaca
gctggtttccctgatggattgattcaagtagttcagggagctatagatgaaactacaaga
ctactagattgtggaaaatttgacctaatattctacacaggttctccccgtgtcggatca
atagttgctgagaaagcagcaaaaagtctaacaccttgtgtacttgaacttggtggtaaa
tcacctacctttattacagaaaatttcaaagcaagtaacataaaaattgctttgaaaagg
attttttttggtgctttcggaaattctggccagatttgtgtttcaccagattatttgtta
gtacataaatctatctatccaaaagtcattaaagagtgtgaatcagtactaaatgaattt
tatccaagctttgatgaacaaacagatttcactcgtatgattcatgagcctgcttacaaa
aaggccgttgcaagtataaactcaactaacggctccaagattgtgccttcaaaaatttct
atcaattcagatactgaggatctatgccttgtaccaccaaccatagtttataacattggt
tgggatgatcctttgatgaaacaggaaaactttgctcctgtattgcccatcattgagtac
gaggatcttgatgagaccattaacaagataatagaagaacatgacactccattggtgcaa
tacatattctctgatagccaaactgaaataaatcgtatcttgacgcgcttaagatctggt
gactgtgttgtcggtgatacagtgattcatgtaggaattaccgacgctccatttggaggg
atcggtacttcaggttatggtaactatggtggatattatggattcaatacctttagtcat
gaaagaacaatttttaaacaaccatattggaatgattttaccctttttatgagataccct
ccaaatagcgcacaaaaggaaaagctcgtccgttttgcgatggaaagaaaaccttggttt
gacagaaatggcaataacaagtgggggttacgccaatatttttcattatctgccgccgtt
attttaattagtaccatttacgctcattgttcttcctga

DBGET integrated database retrieval system