KEGG   Saccharomyces cerevisiae (budding yeast): YMR112CHelp
Entry
YMR112C           CDS       T00005                                 

Gene name
MED11
Definition
(RefSeq) Med11p
  KO
K15132  mediator of RNA polymerase II transcription subunit 11, fungi type
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YMR112C (MED11)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Head
     YMR112C (MED11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Med11 Baculo_PEP_C DUF4015 zf-CCCH_6 UPF0242 DASH_Dad3
Motif
Other DBs
NCBI-GeneID: 855139
NCBI-ProteinID: NP_013830
SGD: S000004718
UniProt: Q99278
Structure
PDB: 

Position
XIII:complement(494100..494495)
Genome map
AA seq 131 aa AA seqDB search
MQVLNTKSETKQENETMQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESV
KPQFENHVKQFYERLDKSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDL
LSAILDPSKSK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttctcaatacgaagagtgaaacgaaacaagaaaacgaaacaatgcagccacca
tatatacaagaacgtcttaagtcattaaatgatatagagacccagttatgctccatgttg
caggaggcgtctcaagtcacgttcatatttggtgaactaaaaagaggtaatgaatcagtg
aaaccccaattcgaaaatcatgtcaaacagttttacgaacgactagataaatcaaccaca
cagctacgcaaggagatacagttgttggatgagaacgttggaacacgactactgcccatc
aatgtcaacaagaaggccctaggccaagacacagaaaaaatggaagaacaattggattta
ttgtcggctatattagatccttcgaaatccaagtaa

DBGET integrated database retrieval system