KEGG   Saccharomyces cerevisiae (budding yeast): YMR113WHelp
Entry
YMR113W           CDS       T00005                                 

Gene name
FOL3
Definition
(RefSeq) dihydrofolate synthase
  KO
K20457  dihydrofolate synthase [EC:6.3.2.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00790  Folate biosynthesis
sce01100  Metabolic pathways
Module
sce_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YMR113W (FOL3)
Enzymes [BR:sce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.12  dihydrofolate synthase
     YMR113W (FOL3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-GeneID: 855140
NCBI-ProteinID: NP_013831
SGD: S000004719
UniProt: Q12676
Position
XIII:494999..496282
Genome map
AA seq 427 aa AA seqDB search
MAIELGLSRITKLLEHLGNPQNSLRVLHIAGTNGKGSVCTYLSSVLQQKSYQIGKFTTPH
LVHVTDSITINNKPIPLERYQNIRLQLEALNKSHSLKCTEFELLTCTAFKYFYDVQCQWC
VIEVGLGGRLDATNVIPGANKACCGITKISLDHESFLGNTLSEISKEKAGIITEGVPFTV
IDGTNEASVINVVKERCKALGSELSVTDSQLNGNMIDTNSWGCFDLAKLPLNGEYQIFNL
RVAMGMLDYLQMNELIDITKNEVSTRLAKVDWPGRLYRMDYRFDKVSNRTVPILMDGAHN
GSAAVELVKYLRKEYGNQPLTFVMAVTHGKNLEPLLQPLLRPIDQVILTRFNNVEGMPWI
HATDPEEIKDFILTQGYTKEIVIENDLHQVLPSLAHVSDEQRRPIVVCGSLYLCGELLRI
HNSHLRN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggccattgaattgggactttcccgtattacaaaactactagagcatttaggcaatccg
caaaactcacttagagtgctgcacattgcagggacaaatggtaaaggttcagtatgtact
tacctatcttctgtgttgcaacaaaagtcctaccaaattggaaaatttaccactccacac
ttggtgcatgttactgattccattacaatcaacaataagccgattccgttagagagatac
cagaatattagattacaactagaagctttaaacaagtcacactctttaaaatgtacggaa
ttcgagctattaacatgtaccgcattcaaatatttttatgatgtgcagtgccaatggtgt
gtcatagaagtaggccttggcggaagacttgatgcgaccaatgttattccaggcgcaaat
aaggcatgttgtggtattactaaaatcagtttggatcatgaaagctttttaggtaacacc
ttgtctgaaatctctaaagagaaagcaggtataataacagaaggggtacccttcacagtg
attgatggaaccaatgaggcaagtgttataaatgttgtgaaagaaagatgcaaggcttta
gggtctgaactatccgttacagattctcaacttaacggaaatatgattgacaccaactcc
tggggttgttttgacttggcaaaattgccactgaatggagaatatcagatatttaatctc
agggtggccatgggtatgttagactacttacaaatgaacgaacttattgatattaccaag
aatgaagtaagtacgagattggcgaaggttgattggccaggaaggttatatcgtatggat
tatcgctttgacaaagtaagtaataggacagtgcctatattaatggacggtgcccacaat
ggctcagctgcagtagagttagttaagtacctaagaaaggagtacggaaaccagcctttg
acctttgtgatggcagtaacgcatgggaaaaacttggagccgctgctccagccattattg
aggcctatagatcaagtaattcttactcggtttaataatgtggaaggtatgccctggatt
catgccactgatcctgaagaaataaaagattttattttgactcaaggatacacaaaggag
atagtgattgaaaatgatttacatcaggtattgccttctctggcgcatgtatcagacgag
caaagacggccaattgttgtatgcggttcactgtatttatgtggtgaattattacggatt
cacaatagtcacttgagaaactaa

DBGET integrated database retrieval system