KEGG   Saccharomyces cerevisiae (budding yeast): YMR115WHelp
Entry
YMR115W           CDS       T00005                                 

Gene name
MGR3, FMP24
Definition
(RefSeq) Mgr3p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_12 TPR_19 TPR_2 TPR_6
Motif
Other DBs
NCBI-GeneID: 855142
NCBI-ProteinID: NP_013833
SGD: S000004721
UniProt: Q04472
Position
XIII:497704..499209
Genome map
AA seq 501 aa AA seqDB search
MLLQGMRLSQRLHKRHLFASKILTWTTNPAHIRHLHDIRPPASNFNTQESAPIPESPANS
PTRPQMAPKPNLKKKNRSLMYSIIGVSIVGLYFWFKSNSRKQKLPLSAQKVWKEAIWQES
DKMDFNYKEALRRYIEALDECDRSHVDLLSDDYTRIELKIAEMYEKLNMLEEAQNLYQEL
LSRFFEALNVPGKVDESERGEVLRKDLRILIKSLEINKDIESGKRKLLQHLLLAQEEILS
KSPELKEFFENRKKKLSMVKDINRDPNDDFKTFVSEENIKFDEQGYMILDLEKNSSAWEP
FKEEFFTARDLYTAYCLSSKDIAAALSCKITSVEWMVMADMPPGQILLSQANLGSLFYLQ
AEKLEADLNQLEQKKSKESNQELDMGTYIKAVRFVRKNRDLCLERAQKCYDSVIAFAKRN
RKIRFHVKDQLDPSIAQSIALSTYGMGVLSLHEGVLAKAEKLFKDSITMAKETEFNELLA
EAEKELEKTTVLKAAKKEGLN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcttttacaaggaatgcgtttatcgcaaaggttacataagagacatctatttgcttcc
aagattttaacgtggactacgaaccctgctcatatacgccacctacatgatataaggccg
cctgcatcaaacttcaatacgcaagaatcggcccccataccggagtctccagcaaactca
ccaactcgaccacagatggcacctaaacccaatttgaaaaaaaaaaatcgtagtttaatg
tattctattattggggtttccatagtaggtttatatttttggtttaaaagtaactccagg
aaacaaaaactacctctttcggcgcaaaaagtctggaaggaagccatatggcaagaaagt
gataaaatggattttaattacaaagaagcgttaaggcggtatattgaggcgttggatgaa
tgcgatcgctctcatgtcgatttattgtcagatgattataccagaatagagctgaaaatt
gctgaaatgtatgaaaagctcaatatgcttgaagaagcccaaaatttgtaccaagaatta
ttaagtcggtttttcgaagcgctgaatgttcctggcaaagttgatgagagtgaaagaggc
gaggttttaagaaaagacttgagaatcttgattaaatcgttagaaatcaataaggacata
gaaagtggcaagagaaaattgctacaacatttacttttagctcaagaggaaattttaagc
aaatcgccagagttgaaggaattttttgaaaacagaaaaaagaagctctcgatggtaaaa
gacatcaatagagaccctaatgatgattttaaaacatttgttagtgaggaaaatattaag
tttgatgagcaaggctatatgattttggatctggaaaagaatagcagcgcttgggaaccc
tttaaggaagaattttttactgcgagagatttatatacagcttattgtctgtcatcaaaa
gacatagctgcagctctaagttgcaagataactagtgtggaatggatggttatggcagac
atgccaccaggacagatattgctatcacaggcaaatttggggtcattgttctatcttcaa
gcagaaaagctagaagctgacttaaatcaattagagcaaaagaaaagtaaagagtccaac
caagagttagatatgggaacatacataaaagccgttagattcgtacgcaaaaatcgtgac
ttatgtctggaaagagcacaaaaatgttacgacagcgttattgcgtttgccaaaagaaac
agaaaaattaggtttcatgtgaaggatcaactggatccttcaattgcacagtcaattgct
ctatctacctatggaatgggggttttaagccttcatgaaggtgttttggctaaagctgaa
aaactattcaaagattcgatcactatggccaaggagactgaatttaatgaactccttgca
gaagctgaaaaggaactagaaaagacgacagtcttgaaagcggccaaaaaagagggttta
aactaa

DBGET integrated database retrieval system