KEGG   Saccharomyces cerevisiae (budding yeast): YMR116CHelp
Entry
YMR116C           CDS       T00005                                 

Gene name
ASC1, ASU9, CPC2, NAD1
Definition
(RefSeq) guanine nucleotide-binding protein subunit beta
  KO
K14753  guanine nucleotide-binding protein subunit beta-2-like 1 protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YMR116C (ASC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YMR116C (ASC1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     YMR116C (ASC1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YMR116C (ASC1)
  Exosomal proteins of colorectal cancer cells
   YMR116C (ASC1)
  Exosomal proteins of bladder cancer cells
   YMR116C (ASC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40 Nup160 eIF2A WD40_like KOW
Motif
Other DBs
NCBI-GeneID: 855143
NCBI-ProteinID: NP_013834
SGD: S000004722
UniProt: P38011
Structure
PDB: 

Position
XIII:complement(join(499456..499878,500152..500688))
Genome map
AA seq 319 aa AA seqDB search
MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRS
FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS
MIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKA
WNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEV
FSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQT
LFAGYTDNVIRVWQVMTAN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcatctaacgaagttttagttttgagaggtaccttggaaggtcacaacggttgggtc
acatctttggctacttctgctggtcaaccaaacctattgttgtccgcttcccgtgataag
actttgatctcctggaagttgactggtgacgaccaaaagtttggtgtcccagttagatct
ttcaagggtcacagtcacattgtccaagactgtactttgactgctgacggtgcttacgct
ttgtctgcttcttgggacaagaccttgagattatgggatgttgccaccggtgaaacctac
caaagattcgtcggtcacaagtccgatgttatgtccgttgacattgacaagaaggcttcc
atgattatctctggttcccgtgacaagaccatcaaggtctggaccatcaaaggtcaatgt
ttggccactttgttgggtcacaatgactgggtttcccaagtcagagttgttccaaacgaa
aaagctgatgatgactctgtcaccatcatttctgccggtaacgacaaaatggttaaggct
tggaacttaaaccaattccaaattgaagctgacttcatcggtcacaactccaacatcaac
actttgactgcttccccagacggaactttgattgcttccgctggtaaggacggtgaaatt
atgttgtggaacttggctgctaagaaggctatgtacactttgtctgcccaagatgaagtt
ttctctttggctttctctccaaacagatactggttggctgctgccactgctaccggtatt
aaggtcttttctttggacccacaatacttggtcgatgacttgagaccagaatttgctggt
tacagcaaggccgctgaaccacatgctgtttctttggcttggtctgctgacggtcaaact
ttgtttgccggttacaccgacaacgtcattagagtttggcaagttatgactgctaactaa

DBGET integrated database retrieval system