KEGG   Saccharomyces cerevisiae (budding yeast): YMR120CHelp
Entry
YMR120C           CDS       T00005                                 

Gene name
ADE17
Definition
(RefSeq) bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase ADE17
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
sce00670  One carbon pool by folate
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YMR120C (ADE17)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    YMR120C (ADE17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YMR120C (ADE17)
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     YMR120C (ADE17)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     YMR120C (ADE17)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YMR120C (ADE17)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AICARFT_IMPCHas MGS Dis3l2_C_term
Motif
Other DBs
NCBI-GeneID: 855149
NCBI-ProteinID: NP_013839
SGD: S000004727
UniProt: P38009
Position
XIII:complement(507502..509280)
Genome map
AA seq 592 aa AA seqDB search
MANYTKTAILSVYDKTGLLDLARGLIEKNVRILASGGTARMIRDAGFPIEDVSAITHAPE
MLGGRVKTLHPAVHGGILARDIDSDEKDLKEQHIEKVDYVVCNLYPFKETVAKVGVTIPE
AVEEIDIGGVTLLRAAAKNHARVTILSDPKDYSEFLSELSSNGEISQDLRNRLALKAFEH
TADYDAAISDFFRKQYSEGQAQITLRYGANPHQKPAQAYVSQQDSLPFKVLCGSPGYINL
LDALNSWPLVKELSASLNLPAAASFKHVSPAGAAVGIPLSDVEKQVYFVADIENLSPLAC
AYARARGADRMSSFGDWIALSNIVDVPTAKIISREVSDGVIAPGYEPEALAILSKKKGGK
YCILQIDPNYVPEAVERRQVYGVTLEQKRNDAIINQSTFKEIVSQNKNLTEQAIIDLTVA
TIAIKYTQSNSVCYARNGMVVGLGAGQQSRIHCTRLAGDKADNWWFRQHPRVLEIKWAKG
VKRPEKSNAIDLFVTGQIPTEEPELSEYQSKFEEIPKPFTPEERKEWLSKLTNVSLSSDA
FFPFPDNVYRAVKSGVKYIAAPSGSVMDKVVFSAADSFDLVYVENPIRLFHH
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggccaattacacaaaaaccgcaatcctatccgtctatgacaagacaggtctacttgat
ttagccagaggcctcatcgagaagaacgttcgtattctcgcctccggtggtactgctcgt
atgattcgtgacgctggttttccaatcgaagacgtttctgctatcacacatgccccagaa
atgttgggaggtagagtgaaaactttacatcctgccgttcatggtggtatccttgctagg
gacatcgatagcgatgagaaagacttgaaggaacagcacattgaaaaagtcgattatgtc
gtttgtaacctatacccattcaaagaaactgttgctaaggtgggtgtgactattccagaa
gcagtagaagaaattgatattggtggtgttactctattaagagcagctgctaagaaccat
gctagagtcactattttatctgatccaaaggactactccgaatttttaagtgaattatcc
agtaatggtgaaatctctcaagatttgagaaacagattggcattaaaggctttcgaacac
actgccgattatgatgctgcaatttcagatttcttcaggaaacaatactctgaaggtcaa
gctcaaattactctacgttatggtgccaatccacaccaaaagccggctcaagcttacgtc
agtcaacaagacagtttacctttcaaagtcctatgtggttcaccaggttacattaatttg
ttggatgctctaaattcctggcccctggttaaggaattatccgcctcgttgaatttacca
gcagcagcatcgttcaagcatgtatcaccagctggtgccgctgtgggtatcccattgtct
gatgttgaaaagcaagtttattttgttgccgacattgaaaacttatctcccctggcatgt
gcctatgctagggcccgtggtgctgatagaatgtcttcctttggtgattggattgctctt
tccaacatagttgatgttccaacagctaagatcatatctagagaagtttctgatggtgtt
attgccccaggttatgagcctgaggcgttggccattctatccaagaagaagggaggtaag
tactgcatattacaaattgatccaaactatgttccagaagctgtcgaaagaagacaagta
tacggtgtgactttggaacaaaagagaaacgatgccataatcaatcaatcaactttcaaa
gaaattgtttctcaaaataaaaatctcactgaacaagccataattgatttaacggttgcc
accattgctattaaatatactcaatctaattccgtatgttatgctagaaatggtatggtt
gtcggattgggtgcaggtcaacaatctagaatccattgtacaagattagctggtgataag
gctgataattggtggttcagacaacaccctagagttttggagattaaatgggctaaaggc
gtcaagagaccagaaaaatctaatgctatcgatttattcgtaaccggccaaattccaaca
gaagaaccagaattgtctgaataccaatcgaagttcgaggagattccaaaaccatttact
ccagaagaaagaaaggaatggttgagtaaattaaccaacgtttctttgtcatcggatgca
tttttcccattcccagacaatgtttacagagcagttaaatccggtgtcaaatacattgcc
gctccatctggttctgtcatggacaaggttgtattttcagctgccgattcattcgatttg
gtttacgtagagaacccaatccgtttgttccaccattag

DBGET integrated database retrieval system