KEGG   Saccharomyces cerevisiae (budding yeast): YMR129WHelp
Entry
YMR129W           CDS       T00005                                 

Gene name
POM152
Definition
(RefSeq) Pom152p
  KO
K18725  nucleoporin POM152
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YMR129W (POM152)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YMR129W (POM152)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 855159
NCBI-ProteinID: NP_013848
SGD: S000004736
UniProt: P39685
Structure
PDB: 

Position
XIII:527804..531817
Genome map
AA seq 1337 aa AA seqDB search
MEHRYNVFNDTPRGNHWMGSSVSGSPRPSYSSRPNVNTTRRFQYSDDEPAEKIRPLRSRS
FKSTESNISDEKSRISERDSKDRYINGDKKVDIYSLPLISTDVLEISKQRTFAVILFLII
QCYKIYDLVILKSGLPLSGLLFKNYRFNFISKYFIIDSFFLYVLPSFNIPRLTFKPWVVY
LQILAMLLLNIFISSDHEFVLISLIMTTWRKLYTKELSVTGSAINHHRIFDSSAHFKGAL
TIKILPENTAMFNPLHESYCLPMDTNLFKINSIDVPIRINSTEEIEYIELEYRDLYTNSV
ELRSLSKKDFKIIDNPKSFLKKDQSVLKSHSNDFEEGSTIRYLAVTLQDIGFYQIKKIVD
SKKLNLKIHQSHLVVPYCPIASITGTGSNDRCIGDSDNVSFEIQGVPPMKLAYSKIVNGQ
TFSYVDSSLQPEYFESPLQSSKSKQSFTQGELNDLKWGRNQPVNINLDSSITQDGKFAYK
IDKITDGLGNVVDFTSLPEELKKRYDLSYNFNVHEVPRAALEERFDPKSPTKRSIAIVFE
EIKNWISDIPYVISLSYTDAQDKSKKIMNVTTDSLTKVLQADLPGSYNLEYIESKFCPGE
IVGKSNVLVTMPVAPTMEVKSFPILDQCVGQVGLNFELSFTGAPPYYYNTKIYKLENGER
KLYDAKRYTSEGTRNRFSYSPPKEGNYEIVFDTVSNKLFTEPIKLEPVKEYTFKTSMRVK
PSASLKLHHDLKLCLGDHSSVPVALKGQGPFTLTYDIIETFSSKRKTFEIKEIKTNEYVI
KTPVFTTGGDYILSLVSIKDSTGCVVGLSQPDAKIQVRRDIPSAAFNFFEPIKEAKIKHG
SVTEIPLKLSGEGPFTVKFKHMDYDGNIVKEFENKFQNSYKPALKVSKEGLYQLVDIRDS
SCQGNVIYRNSLYKVSFLEKPKFAIQDNHHITKVTENLFSKEEVCQGMEGTVDLALFGSP
PFILEYDLMAPNGHISTKKIQVATKYASLKLPNQIPGEYITTIKAIFDGNYGESDIHFRE
HQSELIIKQTVHPIPDVAFADGGKTLRACAANVDQISFLEPINLKFLQGESPFSITFSVY
HESTSRTDQYTIDNIDSENFSFEKLYEGMKLGNHAITIDSVVDANGCVNSLISGPRNQIL
VSITDAPKIHILDPSTEYCVGDYVAYQLNGVAPFMIKYEFNGIPLKSKERSSQFVRLASE
PGIISITSLQDSSSQCIVDFTNPKLKSEFDDLSLNIHPIPSVTVSQGNYVTEDIREGDQA
EVIFSFEGTPPFSLTYVRTEETDGKHGKRRSQVVETHKVTDIYSHEYKVITSLQGTYEAI
EITDAYCFAKNDLFFNN
NT seq 4014 nt NT seq  +upstreamnt  +downstreamnt
atggagcacagatataacgtgtttaatgatactccacgagggaaccattggatgggcagt
tctgtgtcaggatcaccacgtccatcttatagcagtcgtcctaatgtaaacacaacacga
cgcttccaatatagtgacgatgagcccgctgagaaaatccgacctttacgctcgaggagc
tttaaaagtactgaaagtaacataagcgatgaaaaatcaaggatatctgaacgtgacagc
aaagaccgctacattaatggtgataaaaaggtagacatttattcactgcctctaatatca
accgatgttttagaaatttccaaacaaaggacatttgcggtgatattgtttttaataatt
caatgttataaaatatatgacctggtaatacttaaatcggggttaccgctttcgggttta
ctgtttaagaactatcgatttaatttcatatccaagtatttcattatagattccttcttc
ctgtatgttttaccatcctttaacattcctaggttgacttttaagccatgggttgtttat
ctccagattttagctatgctactattgaacattttcatatcaagcgatcacgagttcgtt
ttgatttcattaattatgaccacatggagaaaactttatacgaaagaattaagtgtaaca
ggttcagccattaaccatcatcgtatttttgattcttccgctcattttaagggtgctcta
acaatcaagatcctacctgaaaacacagctatgtttaatcctcttcatgaatcatattgt
ttgcccatggataccaatctttttaaaattaactcaattgacgtacccatcagaataaac
tcaactgaagagattgaatatatcgagttggaatatagagatctttacacaaattcggta
gagttacggtctttgagtaagaaagacttcaaaatcatcgataaccccaaatccttttta
aaaaaagatcagtcagttctaaagtcacattcaaacgattttgaagaaggcagtacaatt
cgttatttggctgtaactcttcaagatattggcttttatcaaatcaaaaaaattgttgat
tcaaaaaaactgaatttaaagatccatcagtcacacttggttgtaccctactgtccaatt
gcatctattactggaactggaagcaatgatagatgtattggcgattcagataatgtttct
tttgaaattcaaggtgtgcccccaatgaaattagcatactctaagatcgttaatggtcaa
actttttcatatgtagactccagcttgcaaccagaatattttgagtctcctttgcagtca
agcaaatccaaacaaagttttactcaaggagaactaaacgatttgaaatggggaagaaac
caacctgttaatattaatttagactcttccattacccaggacggcaaatttgcatataaa
attgataaaataactgatggtctgggaaatgtcgtggattttacatctctccctgaagaa
ttaaaaaagcgctatgatctatcttataatttcaatgttcatgaggttccacgtgcagcg
ctagaagaaagatttgatccaaagtcacccacaaaaaggtctattgccatcgtgtttgaa
gaaatcaaaaactggatttcagacattccatatgttattagcctatcctatactgatgca
caagacaagtcgaaaaagataatgaatgttactacagattctttgaccaaagtgttgcaa
gcggatcttccggggtcatataacttagaatatattgaatctaagttttgtccaggtgaa
attgtgggtaaatcaaacgttcttgtaactatgccagttgcacctactatggaagttaaa
tcatttccaatattggaccagtgtgtgggacaggttggtctaaactttgaactatctttt
actggggctccaccatactattataacactaaaatctataagcttgaaaacggtgaaaga
aagttatatgatgcaaagagatacacctctgaaggtacgagaaatcgcttcagctatagt
ccacctaaagaaggtaactatgaaatcgtgtttgatactgtttctaataaattattcact
gaaccaatcaaattggaacctgtaaaagaatatactttcaagacatcaatgagggtgaaa
ccaagcgcatcactaaaattacaccatgatttgaaactctgtttgggtgaccacagcagt
gtcccagtagcactaaaaggccaaggcccttttacgttaacatatgatatcattgaaact
ttttctagcaagaggaaaacttttgaaattaaagaaataaaaaccaacgaatatgtcatt
aaaacaccagtctttactactggtggtgattatattctatctttggtttctatcaaggat
tctaccggctgtgtagttggactcagccaaccagatgctaaaatacaggtgaggagagat
attccatctgctgcattcaatttttttgaacctatcaaagaagctaaaattaagcacggt
tctgtcactgaaattccgctcaaattaagtggagaggggccattcaccgttaagtttaaa
cacatggattacgatggaaacattgtgaaagaatttgaaaacaaatttcagaatagttat
aagcccgctttgaaagtaagtaaagaagggctttaccaattggtcgatattcgtgactca
agttgccaaggtaatgtgatttaccggaacagtctgtataaggtatctttcttggagaag
ccaaaatttgcaattcaagacaatcatcacattacaaaagtaacggaaaatttattctct
aaagaagaagtctgtcaagggatggaaggtacggttgatttggctctatttggttctcca
ccattcatattagaatatgatttgatggcacccaacggtcatatttctacaaaaaaaatt
caggtggcaaccaaatacgcttcactgaaactgcctaatcaaattcctggagagtacata
actactattaaggccatcttcgatggcaattatggtgaaagcgacatacattttagagaa
catcagtcggagctcataatcaaacagacagtgcaccccattccagacgtcgcctttgct
gatggtggtaaaaccttgcgtgcatgtgctgctaatgtagatcaaatctcatttttggaa
ccaataaatttgaaatttttacaaggcgaaagcccattttcaatcacctttagcgtttat
cacgagagtaccagtaggacagatcagtataccattgacaacattgactcagagaacttt
tcatttgaaaagttatatgaagggatgaagttaggtaaccatgccattactattgattct
gttgttgacgcaaatggttgtgttaacagcctcatatctggaccgcgtaatcaaattctt
gtgtcaattactgatgcaccaaagatacatatattagatccttctaccgagtattgtgtt
ggggactatgttgcatatcaattaaacggtgtggcacctttcatgattaagtatgaattc
aacggtattccactaaaatctaaggaacgcagctcccaatttgttagattagcatctgaa
ccgggcattatatctatcacttctttacaggattcatcatcacaatgcattgtcgacttt
acgaaccctaaattaaagagtgaatttgatgacttatctttaaacatacatcctattcct
tccgtaactgtttctcaaggaaattacgttactgaggatatccgcgaaggtgaccaggct
gaagtaatcttttcgtttgaaggtaccccaccattctcactaacttatgtaaggacagaa
gagactgatggaaaacacggcaaaaggaggtcgcaggttgttgagacgcataaagtcact
gatatatattctcatgaatacaaggtaattacaagcttgcaaggtacctacgaggcgatt
gaaattacagatgcttattgttttgccaaaaatgatctttttttcaataactaa

DBGET integrated database retrieval system