KEGG   Saccharomyces cerevisiae (budding yeast): YMR145CHelp
Entry
YMR145C           CDS       T00005                                 

Gene name
NDE1, NDH1
Definition
(RefSeq) NADH-ubiquinone reductase (H(+)-translocating) NDE1
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YMR145C (NDE1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     YMR145C (NDE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox DUF4928
Motif
Other DBs
NCBI-GeneID: 855176
NCBI-ProteinID: NP_013865
SGD: S000004753
UniProt: P40215
Position
XIII:complement(554793..556475)
Genome map
AA seq 560 aa AA seqDB search
MIRQSLMKTVWANSSRFSLQSKSGLVKYAKNRSFHAARNLLEDKKVILQKVAPTTGVVAK
QSFFKRTGKFTLKALLYSALAGTAYVSYSLYREANPSTQVPQSDTFPNGSKRKTLVILGS
GWGSVSLLKNLDTTLYNVVVVSPRNYFLFTPLLPSTPVGTIELKSIVEPVRTIARRSHGE
VHYYEAEAYDVDPENKTIKVKSSAKNNDYDLDLKYDYLVVGVGAQPNTFGTPGVYEYSSF
LKEISDAQEIRLKIMSSIEKAASLSPKDPERARLLSFVVVGGGPTGVEFAAELRDYVDQD
LRKWMPELSKEIKVTLVEALPNILNMFDKYLVDYAQDLFKEEKIDLRLKTMVKKVDATTI
TAKTGDGDIENIPYGVLVWATGNAPREVSKNLMTKLEEQDSRRGLLIDNKLQLLGAKGSI
FAIGDCTFHPGLFPTAQVAHQEGEYLAQYFKKAYKIDQLNWKMTHAKDDSEVARLKNQIV
KTQSQIEDFKYNHKGALAYIGSDKAIADLAVGEAKYRLAGSFTFLFWKSAYLAMCLSFRN
RVLVAMDWAKVYFLGRDSSI
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgattagacaatcattaatgaaaacagtgtgggctaactcctccaggtttagcctacag
agcaagtcggggcttgtgaaatatgccaaaaatagatcgttccatgcagcaagaaatttg
ctagaggacaagaaagtcattttgcaaaaagtggcgcccactactggcgttgttgcgaag
cagtcctttttcaagagaactgggaaatttactttgaaggctttattgtattctgccctc
gcgggtacggcttacgtttcatactcactttaccgagaagctaacccttctacccaagtt
cctcaatcggacacttttccaaacggttcaaagaggaagactttggtaattctgggctcc
ggttggggttctgtgtcgcttttgaaaaatttggacaccacgttgtataatgttgttgtt
gtttctccaagaaattattttctttttactccgctattgccatctaccccagttggtacc
atcgaattgaaatctattgttgaacctgtcaggactattgctagaagatcgcacggtgaa
gtccattactatgaagctgaagcgtacgacgttgatcctgaaaacaaaacaattaaggtc
aaatcttccgctaagaataacgactacgacttggacttgaaatacgactatctggttgtc
ggtgtgggtgctcaaccaaacacttttggtactccgggagtttatgaatattcttctttc
ttgaaggaaatatccgacgctcaagagatcagattaaaaattatgtccagtattgagaaa
gctgcctccctatctccaaaagatcctgagagagcaagattgttgagctttgttgtcgtt
ggtggtggtcccaccggtgtcgaatttgccgctgaattgagagattatgttgaccaggac
ttgagaaaatggatgcccgaattgagtaaagaaattaaagtcactttggtggaggctttg
ccaaacattttgaacatgtttgacaagtatctcgttgactatgctcaagatttattcaaa
gaggaaaaaatcgatttaagattgaaaacaatggttaagaaagttgacgctaccactata
actgccaaaactggcgatggtgacattgaaaatataccgtatggtgtattagtttgggct
acaggtaatgcgccaagagaagtgtctaagaacctaatgactaaattagaggaacaggac
tcaagacgtggtttgttgatagataacaaacttcaacttttgggtgctaagggatctatt
tttgctatcggcgattgtaccttccaccctggcttgttccctaccgctcaagttgcccac
caagaaggtgaatacttggctcagtatttcaagaaagcttataaaatcgatcaattgaac
tggaaaatgacccatgctaaagacgattcagaagtcgctagattaaagaaccaaatagtc
aaaacgcaatcgcaaattgaagacttcaagtacaaccataagggtgctctggcttatatt
ggttcagataaagccattgctgatcttgccgttggtgaagccaaatataggttagccggc
tcattcaccttcctattctggaaatctgcttatttggcaatgtgtctatcctttagaaac
agagttcttgtcgctatggattgggctaaagtttatttcttgggtagagattcatctatc
tag

DBGET integrated database retrieval system