KEGG   Saccharomyces cerevisiae (budding yeast): YMR192WHelp
Entry
YMR192W           CDS       T00005                                 

Gene name
GYL1, APP2
Definition
(RefSeq) Gyl1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RabGAP-TBC
Motif
Other DBs
NCBI-GeneID: 855230
NCBI-ProteinID: NP_013917
SGD: S000004804
UniProt: Q04322
Position
XIII:647118..649280
Genome map
AA seq 720 aa AA seqDB search
MNSNEDIHEERIEVPRTPHQTQPEKDSDRIALRDEISVPEGDEKAYSDEKVEMATTNASS
NFGSNESAKDGESIGAFSNPHEALMQSKLREESQSKTILPSDDLSQQLETEESKVEEALK
RITSPPLPPRADCIEESASALKSSLPPVLAGNKNDQAPLDRPQLPPRQVVNAETLHLKAP
HGNATPSKSPTSAVGNSSSSTPPTLPPRRIEDPLDLAAQKHFLASTFKRNMLFYKSEDNS
IKCDLDKNILNLKEDSKKINNNEIPEEVSSFWLKVIGDYQNILINDIETLHFQLSRGIPA
AYRLVVWQLVSYAKSKSFDPIYETYLTEMAPFDVQEFENQLKMMDEVPSEYVKRISNVLK
AYLLFDPECEFSTDIAYIINMILDVCEEEANAFGLLVRLMKVYGLRLLFLPSASEIDILC
YKFDRLVEEFYPEIHNHMVEKGVRSSMFLPGFFTTLFQKKLPTEIQPRIGDMVFLEGIDS
IMRILATLLSNSRDHLLKMGFDDMLELLKSGLLDAYIKQNDGTRGDTLLSNECMDKLLQD
SMMKVAITPKTMKKYSSEYEEIHRLDNEKEVQYKSITEKNLHLQKHVRKLENDYTSLNRE
HVTIANELVKNRLNIESVLNENNGYKLQILDLKKKLDSEKKKQVLGVYVPNDLKKDLEET
MKKNTQVMDENLKLQDRISELERLIEEIKTANKNGTLFEYSNSKNNPLGAGWSGFKKVFK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgaatgaagatatacatgaagaacgcattgaagttccacgaactccccatcaa
acccagccagagaaagactctgatcgcatcgctctcagggatgaaatatcagtaccagaa
ggcgatgaaaaagcatattcggatgagaaagtagaaatggcaaccacaaatgcatccagt
aactttggctcaaatgaaagtgcaaaagacggcgaatcaatcggcgccttttcaaatccc
catgaggctctgatgcagtcaaaattgagagaagaatcccagagtaaaaccatactacca
tccgatgacctcagccagcaattagaaaccgaagaatccaaagttgaagaggctctaaaa
agaataacctcacccccattaccaccgagggctgactgcatagaagaatctgcatctgct
cttaaatcctcattgcctccagtgctagcaggaaataaaaatgatcaagccccccttgac
cgaccacagttacctccgaggcaggtagttaatgcggaaactcttcatttgaaggcgccc
catggtaatgcgactccctccaaatcaccaacgagtgctgtaggtaattcttcttcatcg
acccctccaaccttaccaccacgccgtatagaagatcctttagacttggctgctcaaaaa
catttcctagcgagtacatttaagagaaatatgctcttttataaaagtgaagataactct
atcaaatgtgatttggataaaaatatactaaatttaaaagaagattcaaaaaaaattaac
aacaatgaaattcctgaagaggttagttcattttggttaaaggttatcggcgactatcaa
aatatcttaataaacgatatcgaaaccttacatttccaactatctcgaggtataccagcc
gcttatcgattggtagtctggcagttagtaagttatgcaaaatcgaaatcctttgaccct
atatatgaaacgtatctaacggaaatggcaccttttgacgtccaggaatttgaaaatcag
ctaaaaatgatggacgaagttccctctgaatacgtaaaacgcataagtaatgtgttaaag
gcttatttactttttgacccagagtgtgagttttctaccgacattgcttatattatcaat
atgattcttgacgtttgcgaggaggaggcaaatgcatttggtctacttgtacgcctaatg
aaagtttacggtttaagactcttgttcttaccaagtgcttctgagatcgatattctttgc
tataaatttgatagacttgtagaagaattttatcctgaaattcacaaccacatggttgaa
aaaggcgtccgttcttccatgtttttgcccggtttcttcacgacactgtttcaaaagaaa
cttcccactgaaattcaaccacgtatcggtgatatggtatttttagaaggtattgactct
attatgagaattttagccacacttttatctaattcccgagaccatctgttaaaaatgggt
tttgatgatatgctggagctattgaaatcaggtctgttagatgcttatattaagcagaat
gatggtacacgcggtgacactcttctctcaaatgaatgtatggataaattactacaagac
tctatgatgaaagtagcaataaccccaaagactatgaagaaatattcttctgaatatgag
gaaattcacagattggacaatgaaaaagaagtgcaatataagtctatcacggaaaaaaat
ttacatttacaaaagcatgttcgtaaattagaaaacgactacacatctttaaatagagag
catgtgacaattgcgaacgagttagtgaaaaatcggcttaatatcgagtctgtattaaat
gaaaataatggttacaaacttcaaattttagatttgaagaaaaagttggattcagaaaaa
aagaagcaagttttaggtgtatatgtgcccaatgatttaaagaaagatttggaagagaca
atgaaaaagaatacccaagtaatggacgaaaatttgaaattgcaggataggatttcagaa
ctagaaaggcttattgaagaaataaaaactgcaaacaaaaatggtacgttattcgaatat
tctaattctaaaaataatcctttgggagccggctggtcaggatttaaaaaggtttttaaa
tag

DBGET integrated database retrieval system