KEGG   Saccharomyces cerevisiae (budding yeast): YMR193WHelp
Entry
YMR193W           CDS       T00005                                 

Gene name
MRPL24
Definition
(RefSeq) mitochondrial 54S ribosomal protein YmL24/YmL14
  KO
K02902  large subunit ribosomal protein L28
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YMR193W (MRPL24)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YMR193W (MRPL24)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    YMR193W (MRPL24)
  Bacteria
    YMR193W (MRPL24)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L28
Motif
Other DBs
NCBI-GeneID: 855231
NCBI-ProteinID: NP_013918
SGD: S000004806
UniProt: P36525
Position
XIII:650036..650812
Genome map
AA seq 258 aa AA seqDB search
MQKIFRPFQLTRGFTSSVKNFRQWRLIETRKIAKQPNYQVGDAKPLHMPKERKKFPDYKY
GESNIFKQSNKGLYGGSFVQFGNNISESKAKTRKKWLPNVVKKGLWSETLNRKISIKMTA
KVLKTISKEGGIDNYLTKEKSARIKELGPTGWKLRYRVLKRKDEIENPPHKDAPIIEMAG
GKKAKIYYDEIVNGSPRKISVGRRRLMSFLYPLEKLEYRSVGKDLNYKKFVELFADVPVK
DILARLEDHKFDLSTITV
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaattttcagaccattccaattaacgagaggctttacctcttccgtaaaaaac
ttcaggcaatggagactgattgaaacaaggaagattgccaaacaaccgaactaccaagtt
ggtgatgctaaacctttacatatgccaaaagaaagaaagaaatttccagattacaagtat
ggggaatctaatatcttcaaacagagtaacaaaggtctatatggtggatctttcgttcag
tttggtaacaatatttctgaaagtaaagccaaaacgaggaagaagtggttgccaaatgtt
gtcaaaaaaggtctctggagtgagactctgaacagaaaaatcagtatcaaaatgaccgct
aaagttttaaaaacaatcagtaaagaaggagggattgacaactatttaacaaaggaaaaa
tctgcaagaataaaagaattagggccgaccggatggaagcttcgttatagggttttaaaa
agaaaagatgaaatagagaatcccccacataaggatgcacctatcatagaaatggctggt
ggtaaaaaggccaaaatttactatgatgaaatagtaaacggctcaccaagaaaaatatca
gttggaagaagaagattgatgtcatttttatatcctttagagaaattggaatataggtca
gtagggaaggacctgaactacaaaaaatttgtcgagttatttgccgacgttccagtcaag
gatatcctagctagattagaggatcataaattcgacttatccaccatcaccgtataa

DBGET integrated database retrieval system