KEGG   Saccharomyces cerevisiae (budding yeast): YMR196WHelp
Entry
YMR196W           CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_63 CAF1-p150_N
Motif
Other DBs
NCBI-GeneID: 855236
NCBI-ProteinID: NP_013923
SGD: S000004809
UniProt: Q04336
Position
XIII:655076..658342
Genome map
AA seq 1088 aa AA seqDB search
MNKLRDKFVDSTVEEERLRENRNHEKYWYRWGPYLSERSWATVREDYSLNGDAWSNFPFE
HANARVFRWGEDGLFGVSDNKQLVCMNVALWNGKDERLKERLFGLTGPQGNHGEDVKELY
FYLDNTPTHSYMKALYKYPFKKAFPYKELVQKNGERGYEDKEFEVYDIDGLYRDSETGDN
PYFDVFFEMAKDDENPSELNFRLTIHNRSKIDSGELYIAPQLFFRNTWAFDGTRTKDKPL
LERDAEAANLINMTHKKYGNCQMVFQPSPGGFSSGTNEEEEDKEVEDIDPLLLFTDNESN
LVKLFNEEKNPSEYTKDAFEEYLVQGKTDAVNPENKGTKACAVYHFKNIPPGEYVTVRYK
FTNDPKNSIFKAQNLAVVDEDEFDLIFDNREEEADNFYWRITPLPISDELRNLQRQAFSG
LLWTKQFYNFTYDAWYNGDANVKPRPPPNRANGRNKNWKHLYIEDILSMPDKWEYPFFAS
WDTAFHCIPLAMIDPEFAKRQLDLLTREWYMHPNGQIPAYEWNFNDVNPPVHAWAVYRVF
KIERNMYNREDRTFLERVFQKLLLNFTWWVNRKDTEGKNVFEGGFLGLDNIGVFNRSEPL
PTGGTLEQADSTGWMAFFSLQMLNIALELAKENPVYEDIASKFFEHFILISDSMSFEYAT
DITGEKCKEVIKQNLWNEADKFYYDAISWGDHKVQLPIRSLVGLIPLYASMTLEPSIIKQ
FRGFKKRVDWFVNNRPEIFDRNIASMSKKGVGERLLLSLVTKERLTAILSRLLDETEFLS
PYGIRSLSKYHEKHPFEMNVNGVEYMVKYLPGESDSGMFGGNSNWRGPIWFPTSFLIMEA
LQRFYLYYGSDFKVECPVGSGDYLNLAEVAEELGYRMIHLFVPDENGERAIHYGDHSKFL
SSDPYFRDYVPFFEYFDGDTGRGLGASHQCGWTALVAKWISDVGISCVRLPRTPRSSVAT
TASTESSEQGPKMKRMARRKSAKSLVNYTATILDLTEEEKRHHRIGGTHSGLTPQSSISS
DKARHLMEEMNEEEGIHETVVPEDRHNFETKLIGKLKDKVKNMKVTDKAKDEDIDPMDPM
SPLNKDVS
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagctaagagacaaatttgtagattctacagtagaagaagaaagattgcgtgaa
aatcgaaatcatgagaaatactggtatcgttggggtccctacttgagtgaaagaagctgg
gcgacagtccgtgaagattattctttaaacggtgatgcttggagcaattttcctttcgaa
catgccaatgcaagagtattccgttggggtgaagatggattatttggtgtctcagataac
aaacaattggtgtgtatgaatgtcgctctgtggaacggtaaagatgaaagattgaaggaa
aggttgttcgggttgactgggccacaagggaaccatggtgaggatgttaaggaattgtac
ttttacctggacaatactcccactcattcatatatgaaagctttatacaagtatcccttt
aaaaaggcctttccatacaaagaattggtgcaaaagaatggtgaaaggggatacgaggat
aaagaattcgaagtttacgatatagatgggctataccgtgatagtgaaaccggtgacaac
ccttatttcgatgttttttttgaaatggcaaaggatgacgaaaaccctagtgaactgaac
tttcggctaactatacataatcgaagtaaaatcgactctggtgagctctacatagctccc
caacttttcttcagaaatacttgggcttttgacggtactagaacaaaggacaagcccttg
cttgaaagagatgcagaagcagcgaacttaatcaatatgactcacaagaaatatggtaat
tgccaaatggtctttcagccatctccaggtgggttctcttccggtacaaacgaggaagag
gaagataaagaggtagaagatatagatcctctgctgctatttaccgataatgagtccaat
ttagtaaaactatttaacgaagaaaagaatccttccgagtacacaaaggatgcttttgaa
gaatatcttgttcaaggcaaaaccgatgctgtaaatcctgaaaataaaggaacaaaggcc
tgcgcagtatatcacttcaaaaatattccgcccggagagtatgttactgtgagatacaaa
tttacaaatgacccaaaaaactctatctttaaggcacaaaacctggctgtcgtagatgaa
gatgagtttgatttgattttcgataacagagaggaggaagctgataacttctactggagg
attacacctttgccaatcagtgatgaattaagaaaccttcaaagacaagctttttctggt
ttgctatggactaaacagttctacaattttacatatgatgcttggtataatggtgacgcc
aatgttaagcctcgccctccccctaatagagctaatggcaggaacaagaactggaagcac
ctttacatcgaagatatcttatcaatgcccgacaaatgggagtatccattttttgcttca
tgggatactgcgtttcactgcattcctttagctatgattgatccagaatttgcaaaacgg
caattggatttattaaccagagagtggtacatgcatcctaacggtcaaattccggcatac
gaatggaacttcaatgacgtaaatccaccagtccatgcatgggctgtgtatcgtgttttc
aagatcgaaagaaacatgtacaaccgtgaagatcgtacatttttagaacgagttttccag
aagcttttgttaaattttacatggtgggtcaacagaaaggatactgaaggtaaaaatgtt
tttgagggcggatttttgggtcttgataatattggcgttttcaacagatcagaaccacta
cccactggcggtacgcttgaacaggctgattctacaggttggatggcctttttcagcctt
caaatgctaaatattgcattagagctcgccaaagaaaacccggtttatgaagatattgcc
tctaaattttttgaacattttatcttaatcagtgactctatgtcctttgaatacgctact
gatattacgggagagaaatgtaaagaagttatcaaacaaaacctatggaatgaagcagac
aaattttattacgatgccatctcttggggtgaccacaaggtgcaactaccaataagatct
ctcgtgggattgatcccactatatgcttctatgactttagagcctagtatcataaaacaa
ttccgcggtttcaagaagagggttgattggtttgtgaacaaccgtccagaaatctttgat
agaaacattgcgtccatgtcaaaaaaaggagtgggagaaagactacttttatccctagtt
actaaggaaagattaacagccatactgtcacgtttgctggatgaaactgagtttttgtca
ccatatggtattagatctctttccaaatatcatgagaagcacccattcgaaatgaatgta
aatggtgtcgaatatatggtcaaatatttgccgggcgaatcagactcgggtatgttcggc
ggtaattctaactggagagggcccatttggtttcctaccagctttttaataatggaagca
ttacaaaggttttacctgtactacggttccgacttcaaagtagagtgtcccgtaggttca
ggagattatttgaatcttgctgaagttgccgaagaacttggatatcgtatgattcactta
tttgttccagacgaaaacggggagcgcgccattcattatggtgatcactctaagtttctg
tcttctgatccatatttcagggattatgtgccattttttgaatactttgacggtgatact
ggaagagggcttggcgcttcacaccaatgtggttggactgctcttgtggccaaatggata
agtgatgtaggtatatcctgtgtaagactacctcgtacgccaagatcatctgtggcaacg
accgcttcaacagagagctctgagcaaggtcccaaaatgaagagaatggcaagacgtaag
agtgcaaagtctttggtaaactacactgccaccattttggacttaaccgaagaagaaaag
cgccatcataggatagggggcacccattctgggttgacaccacaaagcagcatttcaagt
gacaaggctagacatttgatggaggaaatgaatgaagaggaaggtattcacgaaactgtg
gtacctgaagatcgtcacaactttgaaaccaagcttataggcaagctaaaagataaggtg
aaaaatatgaaagtaactgacaaggctaaagatgaggatatagacccaatggacccaatg
agtccgttgaataaggatgtgtcttga

DBGET integrated database retrieval system