KEGG   Saccharomyces cerevisiae (budding yeast): YMR197CHelp
Entry
YMR197C           CDS       T00005                                 

Gene name
VTI1
Definition
(RefSeq) v-SNARE protein VTI1
  KO
K08493  vesicle transport through interaction with t-SNAREs 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04130  SNARE interactions in vesicular transport
sce04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    YMR197C (VTI1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YMR197C (VTI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YMR197C (VTI1)
Membrane trafficking [BR:sce04131]
 SNARE
  SNAP-25[N] (Qb)
   Vti1
    YMR197C (VTI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: V-SNARE_C V-SNARE Sec20 Use1 Fusion_gly Nsp1_C YqjK Prominin Snapin_Pallidin
Motif
Other DBs
NCBI-GeneID: 855237
NCBI-ProteinID: NP_013924
SGD: S000004810
UniProt: Q04338
Structure
PDB: 

Position
XIII:complement(658545..659198)
Genome map
AA seq 217 aa AA seqDB search
MSSLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVN
NSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDSGDRDRLFGDLNASNIDDDQRQQL
LSNHAILQKSGDRLKDASRIANETEGIGSQIMMDLRSQRETLENARQTLFQADSYVDKSI
KTLKTMTRRLVANKFISYAIIAVLILLILLVLFSKFK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagttccctattaatatcatacgaatctgacttcaaaacaaccttagaacaagccaaa
gcgagcttagcagaggccccctcacaaccgttatcacagagaaatactacactgaagcac
gtagaacagcaacaagatgagttgtttgacctgctagatcagatggatgtagaagttaat
aacagcataggcgatgcctcagaacgtgctacgtacaaggcgaagttaagagaatggaag
aagactatacagagcgatatcaaacgaccactgcaatccttagtagactcaggcgatcgt
gatagactttttggagatcttaacgcatctaatattgacgatgaccaaaggcaacagttg
ttgagcaaccatgcaatcttacagaaatcgggagatagactaaaagatgccagtagaata
gcaaatgaaactgaaggaatagggtcacaaataatgatggatttaaggtcacagagagaa
actttggaaaatgcaagacagaccttgtttcaagcggattcatatgtggataaaagtata
aagacactaaaaacaatgactagaaggctagttgctaataaattcataagctatgccatt
atcgcagtccttatattattgattttgctagttttgttctcaaagtttaaataa

DBGET integrated database retrieval system