KEGG   Saccharomyces cerevisiae (budding yeast): YMR205C
Entry
YMR205C           CDS       T00005                                 

Gene name
PFK2
Definition
(RefSeq) 6-phosphofructokinase subunit beta
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00010  Glycolysis / Gluconeogenesis
sce00030  Pentose phosphate pathway
sce00051  Fructose and mannose metabolism
sce00052  Galactose metabolism
sce00680  Methane metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01200  Carbon metabolism
sce01230  Biosynthesis of amino acids
sce03018  RNA degradation
Module
sce_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YMR205C (PFK2)
   00030 Pentose phosphate pathway
    YMR205C (PFK2)
   00051 Fructose and mannose metabolism
    YMR205C (PFK2)
   00052 Galactose metabolism
    YMR205C (PFK2)
  09102 Energy metabolism
   00680 Methane metabolism
    YMR205C (PFK2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YMR205C (PFK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YMR205C (PFK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YMR205C (PFK2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     YMR205C (PFK2)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YMR205C (PFK2)
Messenger RNA biogenesis [BR:sce03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     YMR205C (PFK2)
SSDB
Motif
Pfam: PFK
Other DBs
NCBI-GeneID: 855245
NCBI-ProteinID: NP_013932
SGD: S000004818
UniProt: P16862
Structure
PDB: 
3O8O

Position
XIII:complement(671887..674766)
AA seq 959 aa
MTVTTPFVNGTSYCTVTAYSVQSYKAAIDFYTKFLSLENRSSPDENSTLLSNDSISLKIL
LRPDEKINKNVEAHLKELNSITKTQDWRSHATQSLVFNTSDILAVKDTLNAMNAPLQGYP
TELFPMQLYTLDPLGNVVGVTSTKNAVSTKPTPPPAPEASAESGLSSKVHSYTDLAYRMK
TTDTYPSLPKPLNRPQKAIAVMTSGGDAPGMNSNVRAIVRSAIFKGCRAFVVMEGYEGLV
RGGPEYIKEFHWEDVRGWSAEGGTNIGTARCMEFKKREGRLLGAQHLIEAGVDALIVCGG
DGSLTGADLFRSEWPSLIEELLKTNRISNEQYERMKHLNICGTVGSIDNDMSTTDATIGA
YSALDRICKAIDYVEATANSHSRAFVVEVMGRNCGWLALLAGIATSADYIFIPEKPATSS
EWQDQMCDIVSKHRSRGKRTTIVVVAEGAIAADLTPISPSDVHKVLVDRLGLDTRITTLG
HVQRGGTAVAYDRILATLQGLEAVNAVLESTPDTPSPLIAVNENKIVRKPLMESVKLTKA
VAEAIQAKDFKRAMSLRDTEFIEHLNNFMAINSADHNEPKLPKDKRLKIAIVNVGAPAGG
INSAVYSMATYCMSQGHRPYAIYNGWSGLARHESVRSLNWKDMLGWQSRGGSEIGTNRVT
PEEADLGMIAYYFQKYEFDGLIIVGGFEAFESLHQLERARESYPAFRIPMVLIPATLSNN
VPGTEYSLGSDTALNALMEYCDVVKQSASSTRGRAFVVDCQGGNSGYLATYASLAVGAQV
SYVPEEGISLEQLSEDIEYLAQSFEKAEGRGRFGKLILKSTNASKALSATKLAEVITAEA
DGRFDAKPAYPGHVQQGGLPSPIDRTRATRMAIKAVGFIKDNQAAIAEARAAEENFNADD
KTISDTAAVVGVKGSHVVYNSIRQLYDYETEVSMRMPKVIHWQATRLIADHLVGRKRVD
NT seq 2880 nt   +upstreamnt  +downstreamnt
atgactgttactactccttttgtgaatggtacttcttattgtaccgtcactgcatattcc
gttcaatcttataaagctgccatagatttttacaccaagtttttgtcattagaaaaccgc
tcttctccagatgaaaactccactttattgtctaacgattccatctctttgaagatcctt
ctacgtcctgatgaaaaaatcaataaaaatgttgaggctcatttgaaggaattgaacagt
attaccaagactcaagactggagatcacatgccacccaatccttggtatttaacacttcc
gacatcttggcagtcaaggacactctaaatgctatgaacgctcctcttcaaggctaccca
acagaactatttccaatgcagttgtacactttggacccattaggtaacgttgttggtgtt
acttctactaagaacgcagtttcaaccaagccaactccaccaccagcaccagaagcttct
gctgagtctggtctttcctctaaagttcactcttacactgatttggcttaccgtatgaaa
accaccgacacctatccatctctgccaaagccattgaacaggcctcaaaaggcaattgcc
gtcatgacttccggtggtgatgctccaggtatgaactctaacgttagagccatcgtgcgt
tccgctatcttcaaaggttgtcgtgcctttgttgtcatggaaggttatgaaggtttggtt
cgtggtggtccagaatacatcaaggaattccactgggaagacgtccgtggttggtctgct
gaaggtggtaccaacattggtactgcccgttgtatggaattcaagaagcgcgaaggtaga
ttattgggtgcccaacatttgattgaggccggtgtcgatgctttgatcgtttgtggtggt
gacggttctttgactggtgctgatctgtttagatcagaatggccttctttgatcgaggaa
ttgttgaaaacaaacagaatttccaacgaacaatacgaaagaatgaagcatttgaatatt
tgcggtactgtcggttctattgataacgatatgtccaccacggatgctactattggtgct
tactctgccttggacagaatctgtaaggccatcgattacgttgaagccactgccaactct
cactcaagagctttcgttgttgaagttatgggtagaaactgtggttggttagctttatta
gctggtatcgccacttccgctgactatatctttattccagagaagccagccacttccagc
gaatggcaagatcaaatgtgtgacattgtctccaagcacagatcaaggggtaagagaacc
accattgttgttgttgcagaaggtgctatcgctgctgacttgaccccaatttctccaagc
gacgtccacaaagttctagttgacagattaggtttggatacaagaattactaccttaggt
cacgttcaaagaggtggtactgctgttgcttacgaccgtatcttggctactttacaaggt
cttgaggccgttaatgccgttttggaatccactccagacaccccatcaccattgattgct
gttaacgaaaacaaaattgttcgtaaaccattaatggaatccgtcaagttgaccaaagca
gttgcagaagccattcaagctaaggatttcaagagagctatgtctttaagagacactgag
ttcattgaacatttaaacaatttcatggctatcaactctgctgaccacaacgaaccaaag
ctaccaaaggacaagagactgaagattgccattgttaatgtcggtgctccagctggtggt
atcaactctgccgtctactcgatggctacttactgtatgtcccaaggtcacagaccatac
gctatctacaatggttggtctggtttggcaagacatgaaagtgttcgttctttgaactgg
aaggatatgttgggttggcaatcccgtggtggttctgaaatcggtactaacagagtcact
ccagaagaagcagatctaggtatgattgcttactatttccaaaagtacgaatttgatggt
ttgatcatcgttggtggtttcgaagcttttgaatctttacatcaattagagagagcaaga
gaaagttatccagctttcagaatcccaatggtcttgataccagctactttgtctaacaat
gttccaggtactgaatactctttgggttctgataccgctttgaatgctctaatggaatac
tgtgatgttgttaaacaatccgcttcttcaaccagaggtagagccttcgttgtcgattgt
caaggtggtaactcaggctatttggccacttacgcttctttggctgttggtgctcaagtc
tcttatgtcccagaagaaggtatttctttggagcaattgtccgaggatattgaatactta
gctcaatcttttgaaaaggcagaaggtagaggtagatttggtaaattgattttgaagagt
acaaacgcttctaaggctttatcagccactaaattggctgaagttattactgctgaagcc
gatggcagatttgacgctaagccagcttatccaggtcatgtacaacaaggtggtttgcca
tctccaattgatagaacaagagccactagaatggccattaaagctgtcggcttcatcaaa
gacaaccaagctgccattgctgaagctcgtgctgccgaagaaaacttcaacgctgatgac
aagaccatttctgacactgctgctgtcgttggtgttaagggttcacatgtcgtttacaac
tccattagacaattgtatgactatgaaactgaagtttccatgagaatgccaaaggtcatt
cactggcaagctaccagactcattgctgaccatttggttggaagaaagagagttgattaa

DBGET integrated database retrieval system