KEGG   Saccharomyces cerevisiae (budding yeast): YMR236W
Entry
YMR236W           CDS       T00005                                 

Gene name
TAF9, TAF17
Definition
(RefSeq) chromatin modification protein
  KO
K03133  transcription initiation factor TFIID subunit 9B
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    YMR236W (TAF9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YMR236W (TAF9)
   03036 Chromosome and associated proteins [BR:sce03036]
    YMR236W (TAF9)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     YMR236W (TAF9)
   Coactivators
    SAGA/TFTC/STAGA complex
     YMR236W (TAF9)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     YMR236W (TAF9)
    STAGA complex
     YMR236W (TAF9)
    TFTC complex
     YMR236W (TAF9)
    SAGA complex
     YMR236W (TAF9)
    SLIK complex
     YMR236W (TAF9)
SSDB
Motif
Pfam: TFIID-31kDa
Other DBs
NCBI-GeneID: 855276
NCBI-ProteinID: NP_013963
SGD: S000004849
UniProt: Q05027
Position
XIII:742971..743444
AA seq 157 aa
MNGGGKNVLNKNSVGSVSEVGPDSTQEETPRDVRLLHLLLASQSIHQYEDQVPLQLMDFA
HRYTQGVLKDALVYNDYAGSGNSAGSGLGVEDIRLAIAARTQYQFKPTAPKELMLQLAAE
RNKKALPQVMGTWGVRLPPEKYCLTAKEWDLEDPKSM
NT seq 474 nt   +upstreamnt  +downstreamnt
atgaacggcggaggcaagaatgttttgaataaaaactcagtgggctcagtatcagaagtt
ggtccggactcaacacaagaggaaacgccacgagatgtccgtcttttgcatctgctcctc
gcatcacagtcgattcatcaatatgaggaccaagtaccgctacaattgatggattttgca
cataggtacacacaaggagtccttaaggacgcgttggtttacaacgactacgctggcagt
ggaaattctgccggcagtggattaggagtagaagacatacggcttgccattgcagcgaga
acacaataccaatttaagcctacggcacctaaggagctcatgttacagttagctgcggaa
agaaacaagaaggcattacctcaagtgatgggtacgtggggtgtcaggcttcccccagaa
aaatattgtctcacagcgaaggagtgggaccttgaggacccaaagtctatgtga

DBGET integrated database retrieval system