KEGG   Saccharomyces cerevisiae (budding yeast): YMR240CHelp
Entry
YMR240C           CDS       T00005                                 

Gene name
CUS1
Definition
(RefSeq) U2 snRNP complex subunit CUS1
  KO
K12829  splicing factor 3B subunit 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YMR240C (CUS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sce03041]
    YMR240C (CUS1)
Spliceosome [BR:sce03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    YMR240C (CUS1)
 Complex B
    YMR240C (CUS1)
 Complex C
   U2 SnRNP specific factors
    YMR240C (CUS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF382 PSP Syntaxin_2
Motif
Other DBs
NCBI-GeneID: 855281
NCBI-ProteinID: NP_013967
SGD: S000004853
UniProt: Q02554
Structure
PDB: 

Position
XIII:complement(749930..751240)
Genome map
AA seq 436 aa AA seqDB search
MARTKSRKRSGNNQNKNASVVNNKAEIAAMIDARRLEQKKKGGVTNSKGKTNKVVDAKLE
KEFKDVLQRFQVQENDTPKEITKDEKNNHVVIVEKNPVMNRKHTAEDELEDTPSDGIEEH
LSARKRRKTEKPSLSQLKSQVPYPQIIEWYDCDARYPGLLASIKCTKNVIPVPSHWQSKK
EYLSGRSLLGKRPFELPDIIKKTNIEQMRSTLPQSGLDGQDEKSLKEASRARVQPKMGAL
DLDYKKLHDVFFKIGANWKPDHLLCFGDVYYENRNLFEETNWKRMVDHKRPGRISQELRA
IMNLPEGQLPPWCMKMKDIGLPTGYPDLKIAGLNWDITNLKGDVYGKIIPNHHSRSKKQG
RNYFGALISFETPEFENSKEDTQANAENGRQDDKIDDEVEHKLDHFQEDISEVTSAEEKL
ERNEEESEKQLYTVLK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggctagaaccaaaagtaggaagcgttccggaaataaccaaaataagaatgcgtctgtg
gtaaataataaggctgagatcgccgccatgattgatgcaagaaggcttgagcaaaagaaa
aagggtggggtgactaacagcaaaggaaagacgaataaggtagtggatgcgaagttagaa
aaagagttcaaagacgttttacaacgatttcaagtgcaagagaatgatacgccgaaggaa
atcacgaaagatgaaaagaacaatcatgtcgttattgttgagaaaaacccagttatgaac
agaaagcatacagcagaagatgaattggaggatacaccctcggatggtattgaggagcat
ctatcggcaagaaaacgtaggaagactgaaaaaccttcactttcgcagttaaaaagccag
gtaccgtatcctcaaattatagaatggtacgattgtgacgcaagatatccaggcttacta
gcgtcaattaagtgcaccaaaaatgtcattcctgttccaagccactggcagtccaagaag
gaatatctatctggccgttctctgttaggtaaaagaccttttgaacttcctgacattatc
aagaagacaaatatagaacaaatgagatcgacgcttccgcaaagcggactggatggtcaa
gatgaaaagtcactaaaggaggcctcaagagcaagagtgcagccgaaaatgggcgccttg
gatttggattacaagaagttacacgatgtgtttttcaagataggagccaactggaaacct
gaccatttgttatgcttcggtgacgtctattatgaaaataggaatcttttcgaggaaacg
aactggaaaagaatggttgatcataagagaccggggagaattagccaagagcttcgtgcc
ataatgaatttacccgaaggtcaactaccaccatggtgtatgaagatgaaagacattgga
ttacctacgggatatcctgatctgaaaattgccggcttgaattgggatataacgaattta
aaaggcgacgtttacggaaaaataatccctaatcaccattcaaggtccaagaaacagggt
agaaactattttggcgcattgatctcatttgaaacccctgaatttgaaaattcaaaagag
gatacacaggcgaatgcggaaaatgggcgccaagatgacaaaatcgatgatgaagtagag
cataagttagatcacttccaggaagacatatccgaagtgacaagcgcagaagaaaaactt
gagagaaacgaagaggaatcggagaagcaactatatactgtattgaaataa

DBGET integrated database retrieval system