KEGG   Saccharomyces cerevisiae (budding yeast): YMR241W
Entry
YMR241W           CDS       T00005                                 

Gene name
YHM2
Definition
(RefSeq) Yhm2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 855282
NCBI-ProteinID: NP_013968
SGD: S000004854
UniProt: Q04013
Position
XIII:751961..752905
AA seq 314 aa
MPSTTNTAAANVIEKKPVSFSNILLGACLNLSEVTTLGQPLEVVKTTMAANRNFTFLESV
KHVWSRGGILGYYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKSLGLNNFASGILGGVTG
GVTQAYLTMGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINKGVNAVAI
RQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEKIGASALGGGLSAWNQPIEVIRV
EMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTPRIGLGIWQTVFMVGFGDMAKE
FVARMTGETPVAKH
NT seq 945 nt   +upstreamnt  +downstreamnt
atgccatctaccactaatactgctgcagcaaacgtaatagaaaaaaagccagtctcgttt
tctaatatcctattgggtgcctgtttaaacttgtcagaggtgactacattagggcaacct
ttggaggttgttaagaccacaatggctgcaaacagaaacttcacatttttagaatctgtt
aagcatgtctggtcaagaggtggtatcttgggttactaccaaggtttgattccatgggca
tggatcgaagcctccactaaaggtgctgtgttgctgttcgtgtcagctgaggctgagtat
cgtttcaaaagtttggggttgaacaactttgcctcaggtatattaggtggtgtcacgggt
ggtgtcactcaagcctacttaaccatggggttctgtacctgtatgaaaacggtggaaatt
acaagacataaatctgcctccgcaggtggtgtcccacaatcttcttggagtgtgttcaag
aatatttataaaaaggaaggtattagaggtattaataagggtgttaatgctgttgctatt
agacaaatgaccaactggggttctcgttttggtttgtccagactagtggaagatggtatc
agaaagatcaccgggaaaaccaataaagacgacaagttgaatccgttcgagaaaattggt
gccagtgctttaggtggtggtttaagtgcttggaatcaaccaatcgaagtcattagagtt
gaaatgcaatctaagaaggaagatccaaacagaccaaaaaatttgactgttggtaagaca
tttaaatacatctatcaatcaaatggtctaaagggtctttaccgtggtgtcaccccaaga
attggtttaggtatctggcaaactgtcttcatggttggttttggtgatatggcgaaggaa
tttgtcgccagaatgactggtgaaaccccagttgccaaacattag

DBGET integrated database retrieval system