KEGG   Saccharomyces cerevisiae (budding yeast): YMR242CHelp
Entry
YMR242C           CDS       T00005                                 

Gene name
RPL20A, RPL18A2
Definition
(RefSeq) ribosomal 60S subunit protein L20A
  KO
K02882  large subunit ribosomal protein L18Ae
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YMR242C (RPL20A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YMR242C (RPL20A)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    YMR242C (RPL20A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L18A
Motif
Other DBs
NCBI-GeneID: 855283
NCBI-ProteinID: NP_013969
SGD: S000004855
UniProt: P0CX23 P0CX24
Structure
PDB: 

Position
XIII:complement(join(753225..753742,754220))
Genome map
AA seq 172 aa AA seqDB search
MAHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKVKKASGEIVS
INQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVAAVETLYQDMAARHRARFRS
IHILKVAEIEKTADVKRQYVKQFLTKDLKFPLPHRVQKSTKTFSYKRPSTFY
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggctcactttaaagaataccaagttattggccgtcgtttgccaactgaatctgttcca
gaaccaaagttgttcagaatgagaatctttgcttcaaatgaagttattgccaagtctcgt
tactggtatttcttgcaaaagttgcacaaggttaagaaggcttctggtgaaattgtttcc
atcaaccaaatcaacgaagctcatccaaccaaggtcaagaacttcggtgtctgggttaga
tacgactccagatctggtactcacaatatgtacaaggaaatcagagacgtctccagagtt
gctgccgtcgaaaccttataccaagacatggctgccagacacagagctagatttagatct
attcacatcttgaaggttgctgaaattgaaaagactgctgacgtcaagagacaatacgtt
aagcaatttttgaccaaggacttgaaattcccattgcctcacagagtccaaaaatccacc
aagactttctcctacaagagaccttccactttctactga

DBGET integrated database retrieval system