KEGG   Saccharomyces cerevisiae (budding yeast): YMR243CHelp
Entry
YMR243C           CDS       T00005                                 

Gene name
ZRC1, OSR1
Definition
(RefSeq) Zn(2+) transporter ZRC1
  KO
K14688  solute carrier family 30 (zinc transporter), member 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YMR243C (ZRC1)
Transporters [BR:sce02000]
 Solute Carrier Family (SLC)
  SLC30: Zinc efflux transporter
   YMR243C (ZRC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cation_efflux
Motif
Other DBs
NCBI-GeneID: 855284
NCBI-ProteinID: NP_013970
SGD: S000004856
UniProt: P20107
Position
XIII:complement(754838..756166)
Genome map
AA seq 442 aa AA seqDB search
MITGKELRIISLLTLDTVFFLLEITIGYMSHSLALIADSFHMLNDIISLLVALWAVDVAK
NRGPDAKYTYGWKRAEILGALINAVFLIALCFSIMIEALQRLIEPQEIQNPRLVLYVGVA
GLISNVVGLFLFHDHGSDSLHSHSHGSVESGNNDLDIESNATHSHSHASLPNDNLAIDED
AISSPGPSGQIGEVLPQSVVNRLSNESQPLLNHDDHDHSHESKKPGHRSLNMHGVFLHVL
GDALGNIGVIAAALFIWKTEYSWRYYSDPIVSLIITIIIFSSALPLSRRASRILLQATPS
TISADQIQREILAVPGVIAVHDFHVWNLTESIYIASIHVQIDCAPDKFMSSAKLIRKIFH
QHGIHSATVQPEFVSGDVNEDIRRRFSIIAGGSPSSSQEAFDSHGNTEHGRKKRSPTAYG
ATTASSNCIVDDAVNCNTSNCL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccggtaaagaattgagaatcatctctcttttgaccttagacacggtttttttc
ctattggaaattaccataggttatatgtcacattcattggccttgattgccgattcattt
cacatgttgaatgatatcatctctcttttagtggcactatgggctgtggatgtggccaaa
aacaggggtccagacgctaaatacacttatggatggaaaagagcagaaattttgggtgct
ttaatcaatgctgtttttcttattgccctgtgtttctctattatgattgaagctttacaa
agattgattgaacctcaagaaattcaaaacccaaggttggttttatacgttggtgtagca
gggttaatttctaatgtcgtaggtttatttttgttccacgatcatggcagcgatagtctg
cactcacactctcatggctctgtggaaagcgggaataacgatttggacatagaatctaat
gcgactcattcccactctcatgcatctcttccaaacgataatttggccatcgatgaagat
gctatttcgagtcctgggccctcagggcaaattggtgaagtgttgccacaatcagtagta
aacagattatcaaacgaaagccaacccttattgaaccacgatgatcatgaccacagccat
gaatcgaagaaaccaggtcatcgctctttgaatatgcatggtgtcttcttacatgtacta
ggtgatgctctgggtaatattggtgttattgcagctgctttgtttatttggaaaactgaa
tattcttggagatattactcggatccaatcgtttctttaatcatcaccattattattttc
tcttccgctctgcccttatcacgtagagcttcaagaattttactacaggctactccttct
acaatttctgctgatcagattcaaagagagattttggcagtacctggcgtgatagcggtc
catgacttccacgtctggaacttaactgaatcaatatatattgcatctatccacgttcaa
atagactgtgcacctgataaattcatgagctccgccaagctgataagaaaaatattccat
caacacggtattcattctgcaactgttcaaccagaatttgtttctggagatgttaatgag
gatattcgcagaagattttctatcatagcaggtggttcaccatcttcgtctcaagaagcc
tttgacagccatggaaacactgagcatggtagaaaaaagcgttcacctactgcctatggt
gctactacagcatcatctaattgtattgtagatgacgctgtaaactgcaatacttccaat
tgcctgtaa

DBGET integrated database retrieval system