KEGG   Saccharomyces cerevisiae (budding yeast): YMR246WHelp
Entry
YMR246W           CDS       T00005                                 

Gene name
FAA4
Definition
(RefSeq) long-chain fatty acid-CoA ligase FAA4
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00061  Fatty acid biosynthesis
sce00071  Fatty acid degradation
sce01100  Metabolic pathways
sce01212  Fatty acid metabolism
sce04146  Peroxisome
Module
sce_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YMR246W (FAA4)
   00071 Fatty acid degradation
    YMR246W (FAA4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    YMR246W (FAA4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sce01004]
    YMR246W (FAA4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YMR246W (FAA4)
Enzymes [BR:sce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     YMR246W (FAA4)
Lipid biosynthesis proteins [BR:sce01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   YMR246W (FAA4)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   YMR246W (FAA4)
  Exosomal proteins of breast cancer cells
   YMR246W (FAA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 855288
NCBI-ProteinID: NP_013974
SGD: S000004860
UniProt: P47912
Position
XIII:759807..761891
Genome map
AA seq 694 aa AA seqDB search
MTEQYSVAVGEAANEHETAPRRNIRVKDQPLIRPINSSASTLYEFALECFTKGGKRDGMA
WRDIIDIHETKKTIVKRVDGKDKPIEKTWLYYELTPYITMTYEEMICVMHDIGRGLIKIG
VKPNGENKFHIFASTSHKWMKTFLGCMSQGIPVVTAYDTLGESGLIHSMVETDSVAIFTD
NQLLSKLAVPLKTAKNVKFVIHNEPIDPSDKRQNGKLYKAAKDAVDKIKEVRPDIKIYSF
DEIIEIGKKAKDEVELHFPKPEDPACIMYTSGSTGTPKGVVLTHYNIVAGIGGVGHNVIG
WIGPTDRIIAFLPLAHIFELTFEFEAFYWNGILGYANVKTLTPTSTRNCQGDLMEFKPTV
MVGVAAVWETVRKGILAKINELPGWSQTLFWTVYALKERNIPCSGLLSGLIFKRIREATG
GNLRFILNGGSAISIDAQKFLSNLLCPMLIGYGLTEGVANACVLEPEHFDYGIAGDLVGT
ITAKLVDVEDLGYFAKNNQGELLFKGAPICSEYYKNPEETAAAFTDDGWFRTGDIAEWTP
KGQVKIIDRKKNLVKTLNGEYIALEKLESIYRSNPYVQNICVYADENKVKPVGIVVPNLG
HLSKLAIELGIMVPGEDVESYIHEKKLQDAVCKDMLSTAKSQGLNGIELLCGIVFFEEEW
TPENGLVTSAQKLKRRDILAAVKPDVERVYKENT
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacaatattccgttgcagttggcgaagccgccaatgagcatgaaaccgctcca
agaagaaatatcagggttaaagaccagcctttgattagacccataaactcctcagcatct
acactgtacgaattcgccctggaatgttttaccaagggtggtaagagagacggtatggca
tggagagatattatagatatacatgagacgaaaaaaaccatagtcaagagggtggatggt
aaggataagcccatcgaaaaaacatggttgtactacgaactgactccctacataaccatg
acatacgaggagatgatctgcgtaatgcacgacattggacgtgggctgataaagattggt
gttaaacctaacggtgagaacaagttccacatctttgcctctacttctcacaagtggatg
aaaacttttcttggttgcatgtcacaaggtattcctgtggtcaccgcgtacgacactttg
ggtgagagcggtttgattcactccatggtggaaacagattccgtcgccattttcacggac
aaccagctgttgtccaaattagcagttcctttgaaaaccgccaagaacgtaaaattcgtc
attcacaacgaacccatcgatccaagtgacaaaagacaaaatggtaagctttacaaggct
gccaaggatgctgttgacaaaatcaaggaagttagaccggacataaaaatctacagtttc
gatgaaattattgagataggtaaaaaggccaaggacgaggttgaattgcatttccccaag
cctgaagatccagcttgtatcatgtacacttctggttccactggtacaccaaagggtgtg
gtattgacacattacaacattgtagctggtattggtggtgtgggccataacgttatcgga
tggattggcccaacagaccgtattatcgcattcttgccattggctcatatttttgaatta
acctttgaattcgaagcgttctactggaatggtatcctagggtacgccaatgtcaagact
ttaaccccaacttctacacgtaattgccaaggtgacctgatggagtttaaacctaccgta
atggtgggtgtcgccgcagtttgggaaacagtgagaaaaggtatcctggccaagatcaac
gaattgcccggttggtctcaaacgcttttctggactgtctatgctttgaaagagagaaat
ataccatgtagcggcttgctgagtgggttgatcttcaagagaatcagagaagcaaccggt
ggaaacttaaggtttattctgaacggtgggtctgcaatcagcatagacgcccaaaaattc
ctctccaaccttctatgtcctatgctcattggatatgggctaactgagggtgtggctaat
gcctgtgtcctggagcctgaacattttgattacggtattgctggtgaccttgtcggaact
attacagctaaattggtggatgtcgaagatttgggctattttgccaagaataatcaaggt
gaattgctgtttaagggtgcacccatctgttctgaatactataagaatcctgaagaaact
gctgcggcctttaccgatgatggctggttccgtaccggtgatatcgctgaatggaccccc
aagggacaagttaagatcattgatagaaagaaaaatttggttaagaccttaaatggtgag
tacattgcattggaaaaattagaatccatttacagatcaaatccttacgtccaaaacatc
tgtgtctacgctgatgaaaacaaagttaagcctgtcggtattgtggtccctaacttagga
cacttgtctaagctggctatcgaattaggtataatggtaccaggtgaagatgtcgaaagc
tatatccatgaaaagaagctacaggatgccgtttgcaaagatatgctgtcaactgccaaa
tctcaaggcttgaatggtattgaattattatgtggcattgttttctttgaagaagaatgg
actccagaaaatggccttgttacatccgcccaaaaattaaagagaagagatattctagcg
gctgtcaagccagatgtggaaagagtttataaagaaaacacttaa

DBGET integrated database retrieval system