KEGG   Saccharomyces cerevisiae (budding yeast): YMR247CHelp
Entry
YMR247C           CDS       T00005                                 

Gene name
RKR1, LTN1
Definition
(RefSeq) ubiquitin-protein ligase RKR1
  KO
K22377  E3 ubiquitin-protein ligase listerin [EC:2.3.2.27]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YMR247C (RKR1)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     YMR247C (RKR1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    YMR247C (RKR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-RING_2 FANCL_C zf-rbx1 zf-ANAPC11 zf-C3HC4 zf-C3HC4_2 zf-RING-like RINGv zf-RING_4 Zn_ribbon_17
Motif
Other DBs
NCBI-GeneID: 855289
NCBI-ProteinID: NP_013975
SGD: S000004861
UniProt: Q04781
Structure
PDB: 

Position
XIII:complement(763351..768039)
Genome map
AA seq 1562 aa AA seqDB search
MSFGGINTFQQYNTDLGLGHNGVRISLNYFDGLPDPSLLNSLYSNELKLIFKSLLKRDET
TKEKALMDLSNLISDFNQNEYFFNDIFLLCWSQIYAKLIISDYKVIRLQSHQITIMLVKS
LRKKISKFLKDFIPLILLGTCELDYSVSKPSLNELTECFNKDPAKINALWAVFQEQLLNL
VKEIVVNENEDTISDERYSSKEESEFRYHRVIASAVLLLIKLFVHNKDVSERNSSSLKVI
LSDESIWKLLNLKNGQNTNAYETVLRLIDVLYTRGYMPSHKNIMKLAVKKLLKSLTHITS
KNILKVCPVLPSILNLLATLDDYEDGTIWSYDKSSKEKVLKFLSVSRTSPSPGFFNAVFA
LYSSTKRHSFLDYYLEWLPFWQKSVQRLNEKGFSARNSAEVLNEFWTNFLKFAEDSSEER
VKKMVESEIFNSLSCGKSLSEYTKLNQTLSGVFPPDKWEREIEDYFTSDEDIRKIKVSFE
KNLFALLVTSPNNESAISRLFDFFVQLIETDPSNVFNKYDGVYDALNYFLDSDMIFLNGK
IGKFINEIPTLVQESTYQNFAGIMAQYSNSKFFKMNTDAITSLEDFFIVALSFNLPKTII
LATMNELDNDIYQQLMKSDSLELELYIEDFMKNYKFDDSGEIFKGNNKFLNQRTITTLYR
SAVANGQVEQFCAVLSKLDETFFSTLLLNTDFLSCALYEVSEDTNEKLFKLSLQLAKGNS
EIANKLAQVILQHAQVYFSPGAKEKYVTHAVELINGCNDTSQIFFPANAIEVFARYMPAI
DYRSSLVSSLSTNTHLLLTDDKPINLKNMQKLIRYALFLDALLDALPERVNNHIVAFITV
VSELVTDYNCLSEEPNDLYYDFGHTFFKHGKVNLNFSDIVGNVIQPANGGDAMLTFDIAE
SNSVYFFYYSRVLYKVLLNSIDTVSSTTLNGLLASVESFVTKTVRDQKSTDKDYLLCAIL
LLMFNRSNSKDEITKLRTLLASQLIGIREVELVDQEFKSLALLNNLLDIPQADKQFVPIA
PQRLNMIFRSILKWLDSDLAYEPSFSTVRLLLLDFFTKLMRFEGVRDMGITAFELSERLL
ADSLSMCQIDDTLYLLELRSSCLNLYETLSQGVSKNGEEISEYGDEIQENLIELMFLNFN
QERNNQVSTLFYQKLYKVISSMELKKLESQYKRIFEVVLNDKDIGSNINQSRLLTTLLGS
LVVKTQQDIIIEYELRIQKQTGSDVDGSASDNDVNSKFKLPQKLLQKVTDEVPKEYLEYE
NKNSFIKYLWYWHLILMYFKDTSYNMRQIFIEQLKEAGLINRMFDFITDQIDLRDTEFWK
QVDTKEISEYNIVGNNFSPYKEDIFEECKKLLGHTLYQLFNNVGCLTSIWWLNIKDRTLQ
NDIEKFVSEFISPILIKNEFDDINSKMDRLTSNDDALTIKLNNITNEVKASYLIDDQKLE
ISFKLPKNYPLTNIQVNGVSRVGISEQKWKQWIMSTQHVITGMNGSVLDSLELFTKNVHL
QFSGFEECAICYSILHAVDRKLPSKTCPTCKNKFHGACLYKWFRSSGNNTCPLCRSEIPF
RR
NT seq 4689 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttggtggaatcaatacatttcaacagtataacacagatttagggctcggccat
aatggtgttagaatatccttaaactactttgatggtttgccggatccaagtcttttaaac
tccttgtactcgaacgagctgaaactcattttcaaatctcttctgaaaagagatgaaact
acaaaagaaaaagctttaatggatctttccaatttgatcagcgactttaaccagaatgag
tactttttcaatgacatttttcttctttgttggtcgcagatatatgctaaactgataatt
agtgattacaaggtcatcagactgcaatcacatcaaattactataatgcttgtcaaaagc
cttcggaagaaaatatcgaagtttttaaaggattttatacctttgatacttctcggtaca
tgcgaactcgattatagtgtttccaaaccttctcttaatgaattaacagagtgtttcaac
aaagacccagcaaaaattaacgccttatgggctgtttttcaagaacaactattgaattta
gtaaaggagattgttgtaaacgagaatgaagataccatttctgatgaacgttactccagt
aaagaagaatctgagtttagataccacagagttatagcaagtgccgtattgctgctgatt
aagctttttgttcataacaaagacgtctcagaacgtaattcttccagtcttaaggtgatt
ctttctgatgagtcaatctggaaactacttaacttaaaaaatgggcaaaatacaaatgcc
tacgaaacagttcttcgattgattgatgttctttatacaagaggttacatgccttcccac
aaaaatataatgaagttagcggtgaaaaaactattgaaatcgttgactcatattacgtca
aagaatattctaaaagtatgccctgttctcccatcaatactgaaccttttagctaccttg
gatgactatgaagatgggacaatatggtcatacgataaatcttctaaagaaaaagtactc
aaatttttatcggtttcccgtacttcaccatcgccaggatttttcaatgctgtgtttgca
ttgtacagctcgactaaaagacacagttttcttgattattatcttgaatggcttccattt
tggcaaaaatcggtgcaaagactgaatgaaaagggcttttctgcgagaaacagcgctgag
gttcttaatgagttttggacaaattttttgaagttcgctgaggattcatcagaagaaaga
gtgaaaaaaatggtggaaagtgagatttttaactctctgtcttgcgggaaatctttatct
gagtacacaaaactgaaccagactcttagtggcgtctttccacccgataaatgggagaga
gagattgaagattacttcacttcagacgaagacataagaaaaataaaggtgagctttgag
aagaatctttttgctttattggttacttctcctaataacgaatccgcaattagtcgttta
ttcgatttttttgtgcaattaatcgaaacagatccctcaaatgttttcaacaaatacgac
ggtgtatatgatgctctcaattactttttagattcagatatgattttcttgaatgggaag
atagggaaatttataaacgaaattccaacgttggtccaagaatcaacatatcaaaacttt
gctggtatcatggcacagtactcaaactccaaatttttcaaaatgaatactgacgcgatt
acttcgttggaagacttttttatcgttgcgctttcttttaacttaccaaagacaataatt
ttagccacaatgaatgagttggacaatgatatttatcaacaattaatgaaatcagattcc
ctagaattagaattgtacattgaagactttatgaaaaattataagtttgacgacagtggg
gaaatatttaaaggtaataataaatttttaaatcaaaggactatcaccacactttaccga
agcgcagttgccaatggccaagttgaacaattttgtgctgttttgtctaaattagatgaa
acttttttttcaacgttattgctgaataccgattttctttcttgtgcattgtatgaagtt
tcagaagacactaatgagaaactattcaagttgtcattacagttggctaaagggaattct
gaaatcgctaataagttggcccaagtgattttgcaacatgctcaggtttatttcagcccc
ggggcaaaagaaaaatatgtcacacacgccgtggagctaattaatggctgcaacgatact
tctcagattttttttcccgctaacgcaatcgaagtttttgccagatatatgccagcaatt
gattataggtcatccttagtgagcagcttaagtactaacacgcatttgctccttacagat
gataagcctatcaatttaaaaaatatgcaaaagctcatcaggtatgctctattcttagat
gccctacttgatgctcttccagagcgcgttaataaccatattgttgcatttataactgta
gtttctgagctcgtcactgattataattgcctttcagaggaaccaaatgatctttactat
gattttgggcatacctttttcaaacatggcaaagtaaatttgaacttttctgatattgtt
ggaaacgttattcagcctgctaatggtggtgatgctatgcttacttttgatattgctgaa
agtaattctgtctactttttttattattcaagagtattatataaggttctattgaacagc
attgatactgtttcatccaccacattaaatgggctattagcatcggttgaaagttttgtc
acgaaaactgtgagggatcaaaaatctactgataaagattatctcctatgtgctatatta
ctattgatgtttaacaggtccaactcaaaagatgagataacgaaattaaggacattgctg
gcatctcaattgattgggattagagaagtagaacttgtcgatcaagaattcaagtcgtta
gctcttttaaataatctgctggatatcccacaggcagataaacagtttgttcctatagca
ccgcagagactgaacatgatattccgttcaatactaaaatggttggatagtgatcttgcc
tacgagcctagctttagcaccgttagattgttactactagattttttcaccaaactgatg
aggtttgaaggagtcagagatatgggcataacagcttttgaactttcggaaaggttgctg
gcagactctctatcgatgtgtcaaattgatgacactttatatttgttagaacttcgctct
tcctgtttgaacttatatgaaacattgtcgcaaggcgtttccaaaaatggcgaggaaatc
tcagaatatggtgatgaaattcaagaaaatttgattgaactgatgtttctcaactttaat
caagaaagaaataaccaagtatccacactcttctaccagaaattgtacaaggtcatttcc
tcaatggaactcaaaaagttagaatctcaatacaaaagaatattcgaggttgtattgaat
gataaggatatcggtagtaatattaatcaatcaagattattaactactttgttgggttct
ttggtggtaaaaacacagcaggatattataattgagtatgaactgaggattcaaaaacaa
actggctcagacgtagatggtagtgcatctgataatgatgtaaactcaaaatttaaacta
cctcaaaaattattacaaaaagttactgatgaggtgccaaaagaataccttgaatacgag
aataaaaattcatttattaaatatctatggtattggcacttgatactgatgtacttcaaa
gatacgtcttataatatgagacaaatatttattgaacaattaaaggaagctggtttaatc
aatagaatgtttgatttcataacagatcaaatagatttaagagatactgagttttggaaa
caggtcgacaccaaggaaatttcggaatacaacattgtcggcaataatttctctccttat
aaagaagacatatttgaagaatgtaaaaaacttttgggccatacactttatcagttgttt
aacaacgtcggttgtctaacgagtatttggtggttaaatataaaagataggacattacaa
aatgatattgaaaagtttgtctcagagttcatctccccaattttgatcaaaaatgaattt
gacgatatcaattctaagatggaccgcctgacttctaatgatgatgctttgactattaaa
ttaaataatattactaatgaagtgaaggcaagctatttgattgacgaccaaaagttggag
atttccttcaaactaccaaaaaactaccctttaacaaatatccaagttaatggcgtctct
agagttggtataagtgaacaaaaatggaaacaatggataatgtctacacaacatgtaatt
acaggcatgaatggatccgttttggattcgttggagttgtttactaaaaatgtgcactta
caattttctggtttcgaggaatgtgccatatgttactctatactacatgccgtggatagg
aaactaccttcgaagacatgtccgacttgtaaaaataagttccacggagcatgtctttac
aagtggtttcgatcatcgggtaacaatacatgtccattatgccgtagtgaaattccattt
agaaggtag

DBGET integrated database retrieval system