KEGG   Saccharomyces cerevisiae (budding yeast): YMR255WHelp
Entry
YMR255W           CDS       T00005                                 

Gene name
GFD1
Definition
(RefSeq) Gfd1p
  KO
K18731  mRNA transport factor GFD1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YMR255W (GFD1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     YMR255W (GFD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFD1 MKRN1_C
Motif
Other DBs
NCBI-GeneID: 855297
NCBI-ProteinID: NP_013982
SGD: S000004868
UniProt: Q04839
Structure
PDB: 

Position
XIII:778001..778567
Genome map
AA seq 188 aa AA seqDB search
MPLESIWADAPDEEPIKKQKPSHKRSNNNKKNNNSRWSNESSSNNKKKDSVNKVKNNKGN
HESKTKNKIKETLPREKKPPHSQGKISPVSESLAINPFSQKATEISPPPVSPSKMKTTKT
QSKQDTASKMKLLKKKIEEQREILQKTHHKNQQQQVLMDFLNDEGSSNWVDDDEEELILQ
RLKTSLKI
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcctttagaatctatatgggccgatgcccctgacgaagaaccaataaagaagcagaaa
ccaagtcacaagcggagtaataacaataaaaagaataataatagcaggtggagtaatgaa
tcaagttcaaacaataagaaaaaagattctgtaaacaaagtgaagaataacaaaggtaac
cacgaaagtaaaacgaaaaataaaataaaggaaactcttcccagagaaaagaagccgcct
catagtcagggcaaaatatcgcctgtaagtgaatcattggcgataaatcctttctcccaa
aaagcaacagagatatctcctccaccagtttcacctagcaagatgaaaactaccaaaaca
caatccaaacaggataccgcttctaagatgaagttattaaaaaagaaaattgaagagcag
agggaaatattgcaaaagactcatcacaagaatcaacagcaacaagtgttgatggatttt
ctgaacgatgaagggagctccaactgggttgacgatgatgaagaggagcttatccttcaa
cgtttgaagacctctttgaaaatatga

DBGET integrated database retrieval system