KEGG   Saccharomyces cerevisiae (budding yeast): YMR300CHelp
Entry
YMR300C           CDS       T00005                                 

Gene name
ADE4
Definition
(RefSeq) amidophosphoribosyltransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
sce00250  Alanine, aspartate and glutamate metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YMR300C (ADE4)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YMR300C (ADE4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sce01002]
    YMR300C (ADE4)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     YMR300C (ADE4)
Peptidases [BR:sce01002]
 Cysteine Peptidases
  Family C44
   YMR300C (ADE4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 Pribosyltran GATase_7 GATase_4
Motif
Other DBs
NCBI-GeneID: 855346
NCBI-ProteinID: NP_014029
SGD: S000004915
UniProt: P04046
Position
XIII:complement(865559..867091)
Genome map
AA seq 510 aa AA seqDB search
MCGILGIVLANQTTPVAPELCDGCIFLQHRGQDAAGIATCGSRGRIYQCKGNGMARDVFT
QQRVSGLAGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGINLAHNGNLVNTASLKRYMDE
DVHRHINTDSDSELLLNIFAAELEKHNKYRVNNEDVFHALEGVYRLCRGGYACVGLLAGF
ALFGFRDPNGIRPLLFGERENPDGTKDYMLASESVVFKAHNFTKYRDLKPGEAVIIPKNC
SKGEPEFKQVVPINSYRPDLFEYVYFARPDSVLDGISVYHTRLAMGSKLAENILKQLKPE
DIDVVIPVPDTARTCALECANVLGKPYREGFVKNRYVGRTFIMPNQRERVSSVRRKLNPM
ESEFKGKKVLIVDDSIVRGTTSKEIVNMAKESGATKVYFASAAPAIRYNHIYGIDLTDTK
NLIAYNRTDEEVAEVIGCERVIYQSLEDLIDCCKTDKITKFEDGVFTGNYVTGVEDGYIQ
ELEEKRESIANNSSDMKAEVDIGLYNCADY
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattttaggtattgtattagcaaaccaaaccactccagtagctccggagtta
tgtgatggatgcatttttctacaacatcgtggacaagatgcagctggtatagctacctgt
ggttctcgtggtagaatctaccaatgtaaaggtaatggtatggctcgtgacgtatttacc
caacaacgtgtttccggtcttgctggttccatgggtattgcccacttgagatatcctaca
gccgggtcttcggctaattcagaagcgcaaccattttacgtcaatagtccttacggtatt
aacttggcacataacggtaacttggtgaatactgcatcattgaagagatatatggatgaa
gacgttcatagacatattaacacggacagtgattcggagttactattgaatatttttgct
gctgaactggaaaaacataacaagtacagagttaacaatgaagatgttttccacgcgtta
gaaggtgtttaccgtttatgccgtggcggttatgcttgcgttggtttacttgccggtttt
gcattatttggtttcagagatccaaatggtattaggccattattgttcggtgaaagagaa
aatccggacggcactaaggactatatgttagcttcagaaagtgttgttttcaaagctcac
aactttactaaatatcgtgacttaaagcctggcgaggcagttatcatccctaagaactgt
agcaaaggtgaacctgagttcaaacaagtggttcctattaactcttatagacctgattta
tttgaatacgtatatttcgccagaccggacagtgtcttggatggaatatcagtttatcac
acaagattggctatgggttctaaattagcggaaaatattctaaagcaactgaagccagaa
gatattgatgttgttattcccgtcccagatactgcaagaacatgtgcactagaatgtgct
aatgtgttagggaagccttatagagagggctttgttaaaaacagatacgtgggcaggaca
tttatcatgccaaaccagagggaaagggtttcttcagtaaggaggaagcttaaccctatg
gagtctgaatttaagggtaagaaggttctgatagtggatgattctattgtcagaggtact
acttcaaaagagattgttaacatggccaaggaatccggtgcaacaaaggtttacttcgct
tcagctgccccagccattcgttacaaccatatttatggtattgacttaacagacacaaag
aacttgattgcttataacagaaccgatgaagaagtggcggaagtaatcggttgtgaaaga
gtcatttaccaatcattggaagatttgattgattgttgtaaaactgataaaataaccaaa
ttcgaagatggtgtatttaccggaaattatgtcactggtgttgaagacggttatattcaa
gaattggaagaaaaacgtgaatcgatcgcaaataattcatcagatatgaaggctgaagtc
gatatcggattatataattgtgcagattattga

DBGET integrated database retrieval system