KEGG   Saccharomyces cerevisiae (budding yeast): YMR301CHelp
Entry
YMR301C           CDS       T00005                                 

Gene name
ATM1
Definition
(RefSeq) ATP-binding cassette Fe/S cluster precursor transporter ATM1
  KO
K05663  ATP-binding cassette, subfamily B, mitochondrial transporter ATM
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    YMR301C (ATM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YMR301C (ATM1)
Transporters [BR:sce02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB6, 7 subgroups
    YMR301C (ATM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_29 ABC_ATPase AAA_21 AAA_22 AAA_16 AAA_15 AAA_23 AAA_30 DUF87 SbcCD_C AAA_24 AAA_25 Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 855347
NCBI-ProteinID: NP_014030
SGD: S000004916
UniProt: P40416
Structure
PDB: 

Position
XIII:complement(867555..869627)
Genome map
AA seq 690 aa AA seqDB search
MLLLPRCPVIGRIVRSKFRSGLIRNHSPVIFTVSKLSTQRPLLFNSAVNLWNQAQKDITH
KKSVEQFSSAPKVKTQVKKTSKAPTLSELKILKDLFRYIWPKGNNKVRIRVLIALGLLIS
AKILNVQVPFFFKQTIDSMNIAWDDPTVALPAAIGLTILCYGVARFGSVLFGELRNAVFA
KVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTKGISQVLTAMVFHIIPIS
FEISVVCGILTYQFGASFAAITFSTMLLYSIFTIKTTAWRTHFRRDANKADNKAASVALD
SLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNSGQNLIFTTALTAMMYM
GCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKLRKNEVKIK
NAERPLMLPENVPYDITFENVTFGYHPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILK
LVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENVKFGRIDATDE
EVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEAT
SALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADADKIIVLDNGRVREEGKHLELL
AMPGSLYRELWTIQEDLDHLENELKDQQEL
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttcttccaagatgtcctgtaattgggcgaattgtaagatcaaaatttagatct
ggtctaatccggaaccattcgcccgttatatttactgtgtctaagttatcaacccagcgg
cctctgttattcaattcagctgtgaatttatggaatcaagcacaaaaggatattacgcac
aaaaaatccgtcgagcaattctcgtcggctccaaaagtgaagactcaggtaaaaaagacc
agcaaggccccaaccctctcggaactgaaaatcttgaaagatctatttcgctatatttgg
cccaaaggcaacaataaagtgaggataagggtactgattgcccttggactgttgatatcc
gccaaaattttaaatgttcaagtacctttttttttcaagcaaactattgattcaatgaat
atagcatgggatgatcctacagtcgcccttccggcagcgattggattaaccattctttgc
tatggtgttgcaaggttcggctctgttttattcggcgaactgaggaacgccgtatttgcc
aaagtggcacagaatgccattagaactgtgtcgctacaaactttccagcaccttatgaag
ttagatttgggatggcacttgagtagacaaacgggtggtctgacgagggccatggataga
ggtacaaagggtatatctcaagtgttaacggccatggtattccacattatccctataagt
tttgaaatatctgtcgtttgtgggattttgacgtatcaattcggtgcgtcatttgccgca
ataacattcagtacaatgcttttatactccattttcactataaagacgaccgcatggagg
acacattttagaagggatgctaacaaggccgataacaaagctgccagtgtggctttagat
tctttaattaattttgaggcggtaaaatacttcaacaatgaaaaatatcttgcagataag
tataatggctccttgatgaactatcgtgactctcaaattaaagtatcgcaatctctagca
tttttgaactccggccaaaatctaatttttactactgccctaactgcaatgatgtatatg
ggttgcaccggcgttattggtggcaacttgacagttggtgacttggttctaattaatcag
ttggtttttcaactatcagtaccgctaaattttcttggtagtgtttacagagatttaaag
cagtctctgattgatatggaaacgctatttaagttaagaaaaaatgaagtcaagattaaa
aatgccgaacgtcccttaatgcttccagaaaatgttccctacgatattacttttgagaac
gtcacgtttggatatcatcccgataggaaaattttaaagaatgccagctttaccatccca
gcaggctggaaaaccgcaatagttgggtcttcgggcagtgggaagtccaccattttaaaa
ttagtctttagattttatgatcctgaaagcggaaggatcctcataaacggtagagatatt
aaagaatatgacatcgatgccttgaggaaggtgattggtgtggtaccacaggacacacca
cttttcaatgacactatctgggaaaatgtaaagttcggtcgtattgacgcaaccgacgag
gaagtgataactgtagttgaaaaagcccagctagcacccttaatcaagaaattaccacaa
ggttttgacaccatcgtcggggagcgagggttgatgatcagcggtggtgaaaagcaaagg
ctggcaattgcaagggtactattgaagaatgcaaggatcatgttttttgacgaggccaca
agcgccttggacacacacacagaacaagctctcttacgaaccattagagataactttact
tcgggttcgagaacgagtgtatacatcgcacatagactgaggacaattgcagatgcagac
aagatcatagtccttgacaacggaagagtaagagaggaaggtaagcatcttgaactgttg
gctatgccagggtcattgtaccgcgaactttggaccatacaagaagatctggatcattta
gagaatgaactaaaagaccagcaagaactatga

DBGET integrated database retrieval system