KEGG   Saccharomyces cerevisiae (budding yeast): YMR302CHelp
Entry
YMR302C           CDS       T00005                                 

Gene name
YME2, PRP12, RNA12
Definition
(RefSeq) Yme2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA12 RRM_1 ATPase_2 AAA_14 Hydrolase_3 CP12
Motif
Other DBs
NCBI-GeneID: 855348
NCBI-ProteinID: NP_014031
SGD: S000004917
UniProt: P32843
Position
XIII:complement(870073..872625)
Genome map
AA seq 850 aa AA seqDB search
MLLVRTTSLNVSRMPVPCLARGIGILKGKYRLANLMNAQPSVRHVSSEIQQKDQQAGESN
TATDTGVIHKSDEETLIYFDNVYARTTSVWNPTLWYNLLLRNQSRDAVREKIRNLASPPN
NPIYGLELKSTIPVKRDGGVFATFVVPPKYTKAQVNSLIQQNTARESSKNLLSYFTRASA
FPVKGSPWIEDLRRLPSTTIVIKFQGPALTEEEIYSLFRRYGTIIDIFPPTAANNNVAKV
RYRSFRGAISAKNCVSGIEIHNTVLHIQYENIRRGHLVSNFFTNHTRIAIPVLFALLSIF
AVLVFDPIREFSIEQKITHKYSLSWDNKFWKQLKTLTSSTMTSIKYYWGGPDDNHQRKHL
WEERIEKVNDLKMWLEENNNTFVVIRGPRGSGKHDLVMQHTLQNRANVLYLDCDKLIKSR
TDPMFLKNAASQLGYFPIFPWIDSVTGVLDLTVQGLTGQKTGLSETKESRFRNMLTTSLM
SIRRIALKNYKAFVSTGDGTVNVKEEDYLQQHPEAKPVIVIDRFEGKSEINGFVYKELSD
WAAMLVQMNIAHVIFLTETVASNQRLSESLPNQVFKNLILSDASKENSRNYVLSQLEDYL
YYNKKSKGENVKEPESEKETAENNDSDSEADTSVKKAEVILNEKELQEIDASLEPLGGRM
LDLQAFVRRVKSGEEPSEAVDKMIEQASEQITQMFLSDKIDSNKSAQAWELIELLSANPV
IPFHEIVNKPLFKAAPETGIMELENNGLITVSRDRGVLQEIRPAKPLYRAAFTYLINDPE
LAKVLKTRYLLKVVGFETGRIKKWEEELKPLGKVPDQKLFKTRLDYLSGKINASNAVITK
CEEEIKNLSK
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgttgctagtacgaacgacttccctgaatgtgtcaaggatgccagtgccatgcctcgcc
agaggaataggcatcctcaagggcaaatatagactagcgaacctgatgaatgcccaaccc
tcagtgagacatgtgtcgagcgagatccagcaaaaggatcagcaggcaggagagtcaaac
accgccaccgatactggtgttattcacaaatcagatgaagaaactctgatatatttcgat
aatgtttacgctagaaccacctcggtttggaatccaacactgtggtacaatctcctgcta
agaaaccagtcacgggatgcagtgagggagaaaataaggaatttagccagtccacccaat
aaccccatttatggactggagttgaagtctaccattccagtgaaaagggatggtggtgta
tttgccacatttgtcgttccacccaagtatacaaaagctcaggtaaattctctaatccaa
cagaatacagccagagaatcctctaaaaacttactctcgtacttcactcgagcttctgcc
ttcccagtaaagggttcgccttggattgaggatttaagaagactaccaagtaccactata
gtcatcaagttccaagggcccgccttaacagaagaagaaatatactctttattcagaaga
tatgggacaattattgatattttccctcccactgctgctaacaacaatgtggcaaaggta
agataccgttcattccgtggtgccatttctgccaagaattgtgtttccggtatcgaaatt
cataataccgtcttacacatacaatacgaaaatatcagaagaggccatctagttagtaat
tttttcaccaaccatacaaggattgctattccagttttatttgcgctactttcaatcttt
gctgttttagtgtttgatcctataagagaattttcgattgaacagaagatcactcacaaa
tattctttatcgtgggacaataagttttggaaacaactgaaaacgctaacctcatctacc
atgacttctatcaagtactactggggcggccctgatgataatcaccaaagaaagcattta
tgggaggaaagaatagagaaagtgaatgacctgaaaatgtggcttgaagaaaataataat
acttttgtggttataagggggcctagaggttcagggaaacatgatttggtcatgcaacac
actttgcaaaatagagcaaatgttttgtatttggattgtgataaattgattaagtccaga
acagatcctatgtttttaaaaaatgccgctagtcaattgggttatttcccaatattccca
tggattgactctgtcacaggtgtccttgatttaacagtgcaaggattaacagggcaaaaa
actgggttgtctgagacgaaggaatctcggtttagaaacatgttaactacctcattgatg
tccattagacgtattgctctcaagaattacaaggcttttgtttccaccggtgatgggaca
gttaatgttaaggaagaagattacctacagcaacatccggaagctaaacccgttatcgtc
atagataggtttgagggcaagtcggaaataaatggatttgtgtataaggaactatccgat
tgggcagctatgctagttcaaatgaatattgctcatgtgattttcttaacggaaaccgtt
gcatccaaccaaagattgagcgaatcactacccaatcaagtcttcaaaaacctaatccta
tcagatgcctcaaaagagaattcgaggaactatgtattatcccaattggaggattactta
tattacaataaaaaatccaagggtgaaaacgtaaaagaacctgaatcagaaaaggaaact
gctgaaaataatgattctgatagtgaggccgatacgagtgtcaaaaaagctgaggttatt
ttaaatgaaaaggaattacaggaaattgacgcttctttagagccattgggtggtaggatg
ttagacttacaggcatttgtaagaagggtaaagtcaggagaagagccctcggaagcagta
gacaaaatgattgaacaggcttctgagcaaataactcaaatgtttttaagtgacaagatt
gacagcaataaaagtgcacaagcctgggaattaatcgaattattgagtgcgaacccagtc
attccattccatgaaatcgttaacaagccattattcaaagccgcaccagaaacgggaatc
atggaattggagaataatggtttaataactgtatctagagataggggtgttttacaggaa
atcaggcctgccaaaccgctatacagggcagcattcacatacttgatcaacgatcctgaa
ctcgcaaaagtgctaaaaacccgttacttattaaaggttgtgggttttgaaactggtaga
atcaagaaatgggaagaagaattaaaacctttggggaaagttcctgatcagaaacttttc
aagaccagattggactatttatccggtaaaatcaatgccagtaatgcagtcattaccaaa
tgtgaagaagaaattaaaaacctatctaagtga

DBGET integrated database retrieval system