KEGG   Saccharomyces cerevisiae (budding yeast): YMR311CHelp
Entry
YMR311C           CDS       T00005                                 

Gene name
GLC8
Definition
(RefSeq) Glc8p
  KO
K16833  protein phosphatase inhibitor 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YMR311C (GLC8)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YMR311C (GLC8)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YMR311C (GLC8)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     YMR311C (GLC8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IPP-2 DUF3135 PEHE
Motif
Other DBs
NCBI-GeneID: 855359
NCBI-ProteinID: NP_014042
SGD: S000004928
UniProt: P41818
Position
XIII:complement(896914..897603)
Genome map
AA seq 229 aa AA seqDB search
MGGILKNPLALSPEQLAQQDPETLEEFRRQVYENTQKNAKLTSHKRNIPGLDNTKEEGEI
IGTSSTFLPKDTLSLKHEQDMLAKMTPEERVQWNQRNLAENEITKKQFQDIHIDEPKTPY
QGAVDPHGEYYRVDDDEDEDNSDKKPCQVANDDIDDLSLGEPEFEIKENKQPDFETNDEN
DEDSPEARHKKFEEMRKKHYDVRAIFNKKSREALKDEDEDEDDSTTKEP
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgggaggtatacttaaaaacccgctagccttatcgccggagcagctggcgcaacaggat
ccagaaacgcttgaagagtttagaagacaagtttacgaaaatacgcagaaaaatgccaaa
ttgacatcacataaaaggaatataccgggactagataatacaaaagaggagggggagata
attggaacatcgagtaccttccttccaaaggacacactgtcactgaaacatgagcaagac
atgttggccaagatgacaccagaagagcgagttcaatggaaccaaagaaatttagcagaa
aatgaaataacaaaaaagcagttccaagatattcacatagacgagcccaagaccccctac
caaggtgctgtggaccctcacggggaatactacagagtagatgatgatgaagatgaggat
aatagtgataaaaaaccatgccaggtggcaaacgatgacatcgacgatttgtccctgggc
gaaccggaatttgaaatcaaagagaacaaacaaccggattttgagaccaacgacgagaat
gatgaagactcaccggaggctagacataagaaatttgaagaaatgagaaagaagcattac
gacgtaagggcaattttcaacaaaaagtcccgtgaagcgctaaaggacgaagacgaagac
gaagatgatagtacgacaaaagaaccatga

DBGET integrated database retrieval system