KEGG   Saccharomyces cerevisiae (budding yeast): YNL007C
Entry
YNL007C           CDS       T00005                                 

Symbol
SIS1
Name
(RefSeq) type II HSP40 co-chaperone SIS1
  KO
K09510  DnaJ homolog subfamily B member 4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sce03110]
    YNL007C (SIS1)
Chaperones and folding catalysts [BR:sce03110]
 Heat shock proteins
  HSP40 / DNAJ
   YNL007C (SIS1)
SSDB
Motif
Pfam: DnaJ_C DnaJ BCSC_C
Other DBs
NCBI-GeneID: 855725
NCBI-ProteinID: NP_014391
SGD: S000004952
UniProt: P25294
Structure
PDB: 
4RWU 1C3G 2B26 6D6X

Position
XIV:complement(618507..619565)
AA seq 352 aa
MVKETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK
REIYDQYGLEAARSGGPSFGPGGPGGAGGAGGFPGGAGGFSGGHAFSNEDAFNIFSQFFG
GSSPFGGADDSGFSFSSYPSGGGAGMGGMPGGMGGMHGGMGGMPGGFRSASSSPTYPEEE
TVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQGDYN
PQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRV
QPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAIDENF
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggtcaaggagacaaaactttatgatttacttggagtatctccaagtgctaatgagcaa
gaactgaaaaagggttatagaaaagcagctctaaaatatcatccagataagccaacaggt
gacacagaaaagtttaaggagatatcagaggcctttgaaattttaaatgatcctcaaaaa
agggaaatatatgatcaatacggtctcgaggctgctagatctggtggtccaagctttggt
cctggtggtcctggcggtgctggaggtgctggaggcttccctggcggtgcgggcggattc
tccggaggacatgcgttcagtaatgaggatgctttcaatattttttcacaattctttggc
ggcagttccccattcggtggtgctgatgacagtggcttcagtttctctagttatccatct
ggcggcggtgctggtatgggaggtatgcctggaggaatgggaggaatgcatggcggcatg
ggaggtatgcctggcggctttagatcagcatcaagctctcccacgtatccagaggaagaa
acagttcaagttaatttaccagttagtctagaagatttgtttgttggtaaaaagaagtca
tttaaaattggaagaaagggcccacatggggcctctgaaaagacacaaattgacattcaa
ttaaaaccgggttggaaagctggtaccaaaataacatacaagaaccagggtgattacaat
cctcaaacgggccgtagaaagactttgcagtttgtcatccaggaaaagagccatccaaac
tttaaaagagacggtgatgacctaatttacactctgccactatctttcaaggaatcattg
ttaggtttttcaaaaactatccaaacaattgatggcagaaccttacctttgtcgagagta
cagcctgtccaaccctcacaaacttctacttatcctggtcaaggtatgccaactccaaag
aacccatctcagagaggtaatttgattgtaaaatataaagtggactatccaatatcacta
aacgacgctcaaaaacgtgctatagatgaaaatttttaa

DBGET integrated database retrieval system