KEGG   Saccharomyces cerevisiae (budding yeast): YNL021W
Entry
YNL021W           CDS       T00005                                 

Gene name
HDA1
Definition
(RefSeq) histone deacetylase HDA1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YNL021W (HDA1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YNL021W (HDA1)
   04131 Membrane trafficking [BR:sce04131]
    YNL021W (HDA1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YNL021W (HDA1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     YNL021W (HDA1)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YNL021W (HDA1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     YNL021W (HDA1)
Membrane trafficking [BR:sce04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    YNL021W (HDA1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     YNL021W (HDA1)
SSDB
Motif
Pfam: Arb2 Hist_deacetyl
Other DBs
NCBI-GeneID: 855710
NCBI-ProteinID: NP_014377
SGD: S000004966
UniProt: P53973
Structure
PDB: 
5J8J

Position
XIV:593227..595347
AA seq 706 aa
MDSVMVKKEVLENPDHDLKRKLEENKEEENSLSTTSKSKRQVIVPVCMPKIHYSPLKTGL
CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK
IPVRAATSEEILEVHTKEHLEFIESTEKMSREELLKETEKGDSVYFNNDSYASARLPCGG
AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM
ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNIT
WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH
MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKV
IRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQQHYLSDEFNFVTLPL
VSMDLPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNVISGTIDLSSSVIIDNSLDFIKW
GLDRKYGIIDVNIPLTLFEPDNYSGMITSQEVLIYLWDNYIKYFPSVAKIAFIGIGDSYS
GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN
ESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDFILDSFEEWSDEE
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggattctgtaatggttaagaaagaagtactggaaaatccagaccatgatttaaaaaga
aagctagaagagaacaaagaagaagagaatagcctctctactacttctaaaagtaaaagg
caggttattgttcccgtttgcatgccaaaaatccattattcaccgctgaaaactggtctt
tgctatgacgttagaatgaggtatcatgcaaagattttcacatcgtacttcgagtacatt
gatccacatccagaggacccaagaagaatatatcgtatttataaaatactagcagagaat
ggtctgattaacgaccccactttaagcggcgtggatgaccttggtgatttaatgctgaag
atacctgtaagagccgcaacctccgaagaaatcttggaagttcatacaaaggaacattta
gagtttattgaaagcacagaaaaaatgagccgagaagagttattaaaagagactgaaaaa
ggtgattccgtatatttcaataatgattcttacgcgagtgctaggctgccttgtggtggc
gccattgaagcatgcaaggcggttgtcgaggggcgtgtaaaaaactctctagctgtcgta
agaccacctggccatcatgcagagcctcaagctgcgggtggtttttgtctcttcagtaat
gttgctgttgctgccaagaatatcttaaagaactacccagaaagtgtaagaaggataatg
attttagattgggatattcatcatggtaatggcacacaaaagtcattctatcaagacgat
caggtgctatatgtgtcattacacagatttgaaatgggtaaatactatcctgggaccatc
caaggacaatatgatcaaactggtgagggtaagggtgaaggattcaattgtaatattact
tggccggtcggcggtgttggtgatgcagaatatatgtgggcatttgaacaggtagttatg
cctatggggagagaattcaagcctgacttggtgattatttcttcagggtttgatgccgcg
gatggtgatactatcggacaatgtcatgtcaccccaagttgttatggacacatgacacat
atgttaaaatctctagctagaggtaatctttgtgtagttttggaaggtggatataacttg
gatgcgattgcaagaagcgctttgagtgtagcaaaagtactaataggggagcctcctgat
gaactacctgatccattaagtgatcccaagcctgaggtcatagaaatgatagacaaagta
attcggttacagtccaagtattggaactgttttagaaggagacatgctaactccggttgt
aattttaacgaacctattaacgactcgataatatctaaaaattttcctctgcagaaggct
attcgtcaacaacagcaacactatttaagcgacgaatttaatttcgttactttaccgtta
gtaagcatggatttaccagataatacagtgctatgtactccaaacatttccgaatctaac
actataattatagtcgttcatgatacttctgatatctgggcaaagagaaatgttatttca
ggtacaattgacttatcctcatcagttatcattgataattctctagactttatcaaatgg
ggacttgacaggaaatacggcatcattgatgtaaatatacctctaactctgtttgaacct
gacaattactcaggaatgattacatcccaagaagttctaatatatttatgggataactac
atcaagtattttccttctgttgccaaaattgcttttattggaataggagactcatactca
ggtatcgtacatctgcttggtcacagggatactagggctgttactaaaacggtaattaat
ttcttgggagacaagcagttaaagccactagttcctctagtagatgaaacattgagtgaa
tggtacttcaaaaactcacttatattttcaaacaatagccaccaatgctggaaagaaaat
gaaagcagaaaaccaagaaaaaaattcggtagagttttgagatgtgatacggacgggtta
aacaatataattgaagaaagatttgaagaggctacagactttatactggattcgtttgaa
gaatggagtgatgaagaatga

DBGET integrated database retrieval system