KEGG   Saccharomyces cerevisiae (budding yeast): YNL030W
Entry
YNL030W           CDS       T00005                                 

Gene name
HHF2
Definition
(RefSeq) histone H4
  KO
K11254  histone H4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YNL030W (HHF2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    YNL030W (HHF2)
SSDB
Motif
Pfam: CENP-T_C TAF Histone CBFD_NFYB_HMF CENP-S TFIID-31kDa Bromo_TP TFIID_20kDa
Other DBs
NCBI-GeneID: 855701
NCBI-ProteinID: NP_014368
SGD: S000004975
UniProt: P02309
Structure
PDB: 

Position
XIV:576727..577038
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLK
SFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtccggtagaggtaaaggtggtaaaggtctaggaaaaggtggtgccaagcgtcacaga
aagattctaagagataacattcaaggtatcactaagccagctatcagaagattagctaga
agaggtggtgtcaagcgtatttctggtttgatctacgaagaagtcagagccgtcttgaaa
tccttcttggaatccgtcatcagggactctgttacttacactgaacacgccaagagaaag
actgttacttctttggatgttgtttatgctttgaagagacaaggtagaaccttatatggt
ttcggtggttaa

DBGET integrated database retrieval system