KEGG   Saccharomyces cerevisiae (budding yeast): YNL031CHelp
Entry
YNL031C           CDS       T00005                                 

Gene name
HHT2
Definition
(RefSeq) histone H3
  KO
K11253  histone H3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YNL031C (HHT2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YNL031C (HHT2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    YNL031C (HHT2)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YNL031C (HHT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CENP-S PAF CENP-T_C CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 855700
NCBI-ProteinID: NP_014367
SGD: S000004976
UniProt: P61830
Structure
PDB: 

Position
XIV:complement(575640..576050)
Genome map
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTI
QKKDIKLARRLRGERS
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggccagaactaaacaaacagctagaaaatccactggtggtaaagccccaagaaaacaa
ttagcctccaaggctgccagaaaatccgccccatctaccggtggtgttaagaagcctcac
agatataagccaggtactgttgccttgagagaaattagaagattccaaaaatctactgaa
ctgttgatcagaaagttacctttccaaagattggtcagagaaatcgctcaagatttcaag
accgacttgagatttcaatcttctgctatcggtgctttgcaagaatccgtcgaagcatac
ttagtctctttgtttgaagacactaatctggctgctattcacgctaagcgtgttactatc
caaaagaaggatatcaaattggccagaagactaagaggtgaaagatcatga

DBGET integrated database retrieval system