KEGG   Saccharomyces cerevisiae (budding yeast): YNL035CHelp
Entry
YNL035C           CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 855695
NCBI-ProteinID: NP_014363
SGD: S000004980
UniProt: P53962
Position
XIV:complement(568522..569691)
Genome map
AA seq 389 aa AA seqDB search
MASYSLVESNSFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKASETAIN
DMKVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRHGLLACGTE
LQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ
DEEEDALHQVINYASIHSCGWLSPKRIFTLSHMETFAIHELNDKSDELKEPQPLDFGDVR
EIWNCDYVVDIYPGLIATGKTQENCGELCLLPFKDEKVDTENGIVIPHAHGDEVVRDIFI
PAQHSNMLYSCGEDGCVKIWENKQGPLDIPENFWDYSKKMNVLGDDDREGSINLDEPLII
QKESVSTRPRKEKHKKAKKHSMKSRFKPY
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggctagttattctttagttgaatcgaattctttcgggtcagaaaattggtgtcttaag
ttacagcctagttataaacatggtcttttaactggattaagtaatggcgaaatacgtttg
ctagactggagtactggtaaatcagtacaaaagattaaggcgagcgaaactgcaatcaat
gatatgaaggtcatcggtagcgacttctctgctggtcatctagttagtagcgcctctatc
gacgcggtgaaagttttcgatataaggacgaatgaccgcattgctcaaattcaaaacgag
gccaactccccctttatttccttagattctcgtcatggtctattggcctgtggtaccgaa
ttgcagggaattgacgctgctgtatacatatatgatattcgcaaatgggacactccattg
agatcattaattgactctcaccatgatgacgttacctgtattaaatttcatccttctgac
gtcaatattttgctcagtggttcaactgatggttacacgaacatttatgacttgaaacaa
gatgaggaggaggacgctttacaccaagttattaattatgcgtcaatacattcctgtgga
tggttgtccccaaagaggatatttacactatcacatatggaaacatttgcaattcacgaa
ttgaacgacaaatctgacgaattgaaagagccacaacccttggactttggtgatgtaaga
gaaatatggaactgtgactacgtggtagatatttaccctggactcattgcaaccggtaaa
acccaagaaaattgtggagagttgtgcctcctaccatttaaagatgagaaggtggatact
gaaaacggtattgttatcccacacgcccatggagacgaggtcgtcagagatatttttata
ccagcacaacatagcaacatgttatactcctgtggtgaagatggttgcgttaaaatttgg
gaaaacaaacaggggccgttagatattccagaaaatttttgggattactctaaaaaaatg
aacgtcttaggagatgacgacagagaaggttccattaatttagacgaacctcttattatt
caaaaagaatcggtttccacgaggccaaggaaggagaaacacaagaaagccaagaaacat
tccatgaaaagtcgtttcaaaccatactag

DBGET integrated database retrieval system