KEGG   Saccharomyces cerevisiae (budding yeast): YNL036WHelp
Entry
YNL036W           CDS       T00005                                 

Gene name
NCE103, NCE3
Definition
(RefSeq) carbonate dehydratase NCE103
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    YNL036W (NCE103)
Enzymes [BR:sce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     YNL036W (NCE103)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_CA
Motif
Other DBs
NCBI-GeneID: 855692
NCBI-ProteinID: NP_014362
SGD: S000004981
UniProt: P53615
Structure
PDB: 

Position
XIV:559814..560479
Genome map
AA seq 221 aa AA seqDB search
MSATESSSIFTLSHNSNLQDILAANAKWASQMNNIQPTLFPDHNAKGQSPHTLFIGCSDS
RYNENCLGVLPGEVFTWKNVANICHSEDLTLKATLEFAIICLKVNKVIICGHTDCGGIKT
CLTNQREALPKVNCSHLYKYLDDIDTMYHEESQNLIHLKTQREKSHYLSHCNVKRQFNRI
IENPTVQTAVQNGELQVYGLLYNVEDGLLQTVSTYTKVTPK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctaccgaatcttcatctatattcacattgagtcacaactcaaacctacaagat
atcttggccgccaatgccaaatgggcctcccagatgaacaacatacagccaactttgttc
ccagatcacaatgcgaagggccagtcccctcacactcttttcatcggctgctccgattcg
cgttacaacgaaaactgtttaggtgtcttgcccggcgaagtgttcacttggaaaaatgtt
gctaacatatgtcactcagaggatttaactttgaaggccactttagagtttgccattatt
tgtctaaaagttaacaaagttattatttgtggccacactgattgtggtggtataaagaca
tgtttaactaaccaaagggaagccttaccaaaagttaactgttctcatctgtacaagtac
ttagacgatattgacaccatgtaccatgaagagtcacaaaatttgatccatttgaaaacg
caacgtgaaaaatctcattacctgtcgcactgtaacgtcaaaaggcagtttaataggatt
attgaaaaccctactgtgcaaactgctgtacaaaatggagaattacaggtatacggtctg
ctttacaacgtagaggacggtctactgcaaacagttagcacttacacaaaagttacccca
aaatag

DBGET integrated database retrieval system