KEGG   Saccharomyces cerevisiae (budding yeast): YNL040WHelp
Entry
YNL040W           CDS       T00005                                 

Definition
(RefSeq) putative alanine--tRNA ligase
  KO
K07050  misacylated tRNA(Ala) deacylase [EC:3.1.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YNL040W
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     YNL040W
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    YNL040W
 Prokaryotic Type
    YNL040W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_SAD tRNA-synt_2c
Motif
Other DBs
NCBI-GeneID: 855688
NCBI-ProteinID: NP_014358
SGD: S000004985
UniProt: P53960
Position
XIV:553380..554750
Genome map
AA seq 456 aa AA seqDB search
MPTPMTPVKVGALACQRNSFLFDGFKTLVVSCEPTKNKKGEIEGYEIELQDTILFPEGGG
QPSDSGFLKIVEGNRNSSKIEKILVSHVSRFGLHAKHHVNDYIEPGTTVEVAVDEQKRMD
YMQQHTGQHLLSAILERNYKVDTVSWSMGGIITKKKPVLEPSDYFNYIELNRKLTLDEIT
NVSDEINQLIINFPQEIIVEERIGEETVDEVSTSKIPDDYDLSKGVLRTIHIGDIDSNPC
CGTHLKCTSQIGSILILSNQSAVRGSNSRLYFMCGKRVSLYAKSVNKILLDSKNLLSCSE
TQISEKITRQTKQIQQLNKREQYWIKRLARTASEELMNTLKASGKKRAYFMEEEYGTLEL
LLQIHKEVSNFLKDDTEGYEIILCGYERQTNTGSLLILSESGEKIANLAANLGSILQNLK
GGGGKKGGKWQGKITSISNAEFAALSDYLSHDFASC
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgcccacacctatgacgcctgtcaaggtcggcgctttagcctgccagaggaactcattt
ctcttcgatgggttcaaaacactggttgtttcttgcgaaccaacgaagaataaaaaggga
gagattgaaggttatgagattgaactacaagatactattctgttccccgaaggtgggggc
caaccaagtgattctggttttttgaaaattgttgaagggaatcgtaattcgtcgaaaatt
gagaagatattagtttcacacgtttctcgtttcggtttacatgcaaagcatcatgtcaat
gactacattgagcccggaacaacagtggaagtggccgtggacgagcaaaagagaatggat
tatatgcaacaacatactggtcaacacttgttaagtgccattctggaacgcaactacaaa
gtagacactgtatcttggtcgatgggtggtatcatcacaaagaaaaaacctgttctagag
cctagcgactatttcaattatatagagttgaacaggaaattgactctcgacgaaataacg
aacgtatcagatgagattaatcagttgatcatcaactttcctcaggaaattattgtagag
gaaagaatcggtgaagaaacagtagatgaagttagtacatccaaaattccagacgattac
gacctctccaaaggtgttctacgtactatccacatcggtgacattgattctaacccatgt
tgtggtacacatttgaaatgtacctctcaaataggttccattttaattctttccaatcaa
tcagccgtaagaggttcaaactcaaggctctatttcatgtgtgggaagcgggtttctttg
tatgcaaaatctgttaataaaattttactggattctaaaaacttattgagttgttcagaa
actcaaatttctgagaagataacaaggcaaaccaaacaaattcaacaattaaataaaaga
gaacagtattggataaagagattagcacgtaccgcttctgaagaattaatgaacacactg
aaagccagtggaaagaaaagggcttattttatggaagaagaatacggaacattggaactg
ttgctacagatccacaaggaagtatctaattttttgaaagatgatacagaaggttacgaa
attatcctatgcggttatgaaagacaaacgaacactggctcactgctaattctttcggaa
tcgggtgaaaaaattgccaatttggctgctaacttaggttcgatactacaaaacctaaaa
ggcggtggtggtaagaaaggtggcaagtggcaaggtaaaattacatccatttcgaatgcc
gagtttgccgccctctctgattatttaagccatgatttcgcatcatgttga

DBGET integrated database retrieval system