KEGG   Saccharomyces cerevisiae (budding yeast): YNL044WHelp
Entry
YNL044W           CDS       T00005                                 

Gene name
YIP3
Definition
(RefSeq) Yip3p
  KO
K20359  PRA1 family protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YNL044W (YIP3)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YNL044W (YIP3)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    YNL044W (YIP3)
Transporters [BR:sce02000]
 Other Transporters
  Others
   YNL044W (YIP3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA1 DUF2207 DUF2627 TLE_N SPC25
Motif
Other DBs
NCBI-GeneID: 855683
NCBI-ProteinID: NP_014354
SGD: S000004989
UniProt: P53633
Position
XIV:join(545268..545291,545371..545877)
Genome map
AA seq 176 aa AA seqDB search
MNQLGALAQVSRFTQNFSMENIKSEFQSLQSKLATLRTPQEFFNFKKISKPQNFGEVQSR
VAYNLKYFSSNYGLIIGCLSIYTLLTNLLLLFVIVLVVAGIVGINKLKGEELVTPFGSFK
TNQLYTGLVCVAVPIGFLASPISTLLWLIGASAVSVFGHASLMEKPIETVFDEETV
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagttaggagctttagcccaagtttcacgtttcactcaaaacttctccatggaa
aatattaagagcgagttccaatccttgcaatctaaattagcaacccttcgcaccccgcaa
gaatttttcaatttcaagaaaatttccaaacctcaaaactttggggaagttcaatccaga
gtggcgtataacctgaagtacttttccagtaactatggtttgattattggttgtttgagc
atttacacattattaacaaacttgttgctactctttgttattgttctagtcgtagctggt
attgttggtataaacaaactaaagggtgaggagctcgtaactccatttggttctttcaag
accaaccaactatacaccggactggtttgtgttgctgtgccaataggtttcttagcttcg
ccaatctcaactttgctatggttgatcggtgcttctgccgtcagcgttttcggacatgca
tcattgatggaaaaacccatcgaaactgtatttgatgaagaaactgtttga

DBGET integrated database retrieval system