KEGG   Saccharomyces cerevisiae (budding yeast): YNL045WHelp
Entry
YNL045W           CDS       T00005                                 

Gene name
LAP2
Definition
(RefSeq) bifunctional aminopeptidase/epoxide hydrolase
  KO
K01254  leukotriene-A4 hydrolase [EC:3.3.2.6]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00590  Arachidonic acid metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    YNL045W (LAP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sce01002]
    YNL045W (LAP2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.6  leukotriene-A4 hydrolase
     YNL045W (LAP2)
Peptidases [BR:sce01002]
 Metallo Peptidases
  Family M1
   YNL045W (LAP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M1 Peptidase_M1_N Leuk-A4-hydro_C ATG11
Motif
Other DBs
NCBI-GeneID: 855682
NCBI-ProteinID: NP_014353
SGD: S000004990
UniProt: Q10740
Structure
PDB: 

Position
XIV:542963..544978
Genome map
AA seq 671 aa AA seqDB search
MFLLPFVIRHSSSIYLPTLRFRGLLTVISRNIHISTPHKMLPLSIEQRRPSRSPEYDQST
LSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHEGKNKSDELHLDTSYLDVQEVHI
DGSKADFQIEQRKEPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGKPY
VFSQLEAIHARSLFPCFDTPSVKSTFTASIESPLPVVFSGIRIEDTSKDTNIYRFEQKVP
IPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGT
YDILVNVDSYPYGGMESPNMTFATPTLIAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFW
LNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDP
DDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPE
KKEILDSVDWETWLYKPGMPPRPHFITALADNVYQLADKWVEMAQHLKTTEDFRSEFNAI
DIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVASRALLDIYQDNIVKSQNAEVVF
KMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVDRRLALATFDKFKDTYHPI
CKALVKQDLGL
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgttcttgcttccatttgtcattcgtcattccagctctatttacctgcccacgcttcga
tttcgaggtttacttactgtaatctcaagaaacatacacatttccacccctcataaaatg
ttgcctctttcaattgagcagagaagaccttcccgctcccccgaatacgatcagtctact
ttatcaaattataaggacttcgcagttcttcacaccgatttaaacctgtctgtttccttc
gaaaagtcagccatttcagggagcgttacattccaattgaaaaaactgcacgaaggtaaa
aataaatcggatgaattacatctggatacatcctatttggatgtccaggaggttcatatt
gatggttccaaggcagattttcaaattgagcaaagaaaggagccattgggctccaggtta
gtcatcaataacgcttcttgcaacgataactttaccttgaatattcaatttcgtacgact
gacaagtgcaccgctttgcaatggttgaacagcaagcaaaccaagggcggtaaaccgtac
gtgttttcacagttggaagctattcatgcgaggtctttgttcccctgctttgatactccc
tctgtgaagtctactttcactgcatctatcgagtccccactaccagtggttttttcaggc
atcaggattgaagatacaagcaaggatactaatatttacagatttgaacagaaagtccct
atcccagcctacctgatcggtattgcttccggtgatttgtcaagcgctccaattggacct
cgttccacagtttacactgaaccatttcgtttgaaagattgtcaatgggaatttgaaaac
gatgtagagaaattcattcaaactgcagagaaaattatctttgaatacgagtggggcact
tatgatatcttagttaacgtcgattcgtacccttacggcggtatggagtctccgaatatg
acttttgctacgcccaccttgattgcacatgacagatccaacattgatgtcatcgcccat
gaacttgctcactcatggtctggtaacttagtgaccaattgttcgtggaatcatttttgg
ttgaatgaaggttggaccgtttacttagaaagaagaattattggtgccattcatggcgaa
ccaactagacatttcagtgctctgattggttggagcgatttgcagaattctattgattct
atgaaagatcctgaaagattttccactttggtacaaaacttgaacgataacactgaccct
gacgatgccttttccactgttccgtacgaaaaggggttcaacttactatttcacttggaa
actattttgggtggtaaggctgaatttgatccatttattagacactatttcaagaagttt
gccaaaaaatcattggatactttccagtttttggatactttgtatgagttctatcccgaa
aagaaagaaattttggattccgttgactgggaaacttggctgtataaaccaggtatgcca
ccaaggcctcattttattacggctttggctgataatgtttatcaattggctgacaagtgg
gtcgaaatggctcaacatttgaaaaccacagaggatttccggtctgaatttaacgctatt
gacattaaggattttaattcaaatcaattggttttgttcttggaaactttgacacaaaat
ggccattccaacaagaaaccaaaagattttgactgggccaagtttcccgtggcatctagg
gcactgttagatatctatcaagataacattgttaaatcacagaacgcggaagttgttttc
aagatgttcaaatttcagatctttgccaagctgcaagaagaatataagcatttggccgat
tggttgggaactgtaggtagaatgaagtttgtccgtcccggttacagactattaaactct
gtagaccgtcgattggcacttgcaactttcgacaaattcaaggacacgtatcatccaatc
tgtaaagctcttgtgaaacaagatttaggtctttga

DBGET integrated database retrieval system