KEGG   Saccharomyces cerevisiae (budding yeast): YNL048WHelp
Entry
YNL048W           CDS       T00005                                 

Gene name
ALG11
Definition
(RefSeq) alpha-1,2-mannosyltransferase ALG11
  KO
K03844  alpha-1,2-mannosyltransferase [EC:2.4.1.131]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00510  N-Glycan biosynthesis
sce00513  Various types of N-glycan biosynthesis
sce01100  Metabolic pathways
Module
sce_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    YNL048W (ALG11)
   00513 Various types of N-glycan biosynthesis
    YNL048W (ALG11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sce01003]
    YNL048W (ALG11)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.131  GDP-Man:Man3GlcNAc2-PP-dolichol alpha-1,2-mannosyltransferase
     YNL048W (ALG11)
Glycosyltransferases [BR:sce01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   YNL048W (ALG11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALG11_N Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_transf_28
Motif
Other DBs
NCBI-GeneID: 855679
NCBI-ProteinID: NP_014350
SGD: S000004993
UniProt: P53954
Position
XIV:538173..539819
Genome map
AA seq 548 aa AA seqDB search
MGSAWTNYNFEEVKSHFGFKKYVVSSLVLVYGLIKVLTWIFRQWVYSSLNPFSKKSSLLN
RAVASCGEKNVKVFGFFHPYCNAGGGGEKVLWKAVDITLRKDAKNVIVIYSGDFVNGENV
TPENILNNVKAKFDYDLDSDRIFFISLKLRYLVDSSTWKHFTLIGQAIGSMILAFESIIQ
CPPDIWIDTMGYPFSYPIIARFLRRIPIVTYTHYPIMSKDMLNKLFKMPKKGIKVYGKIL
YWKVFMLIYQSIGSKIDIVITNSTWTNNHIKQIWQSNTCKIIYPPCSTEKLVDWKQKFGT
AKGERLNQAIVLAQFRPEKRHKLIIESFATFLKNLPDSVSPIKLIMAGSTRSKQDENYVK
SLQDWSENVLKIPKHLISFEKNLPFDKIEILLNKSTFGVNAMWNEHFGIAVVEYMASGLI
PIVHASAGPLLDIVTPWDANGNIGKAPPQWELQKKYFAKLEDDGETTGFFFKEPSDPDYN
TTKDPLRYPNLSDLFLQITKLDYDCLRVMGARNQQYSLYKFSDLKFDKDWENFVLNPICK
LLEEEERG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtgcttggacaaactacaattttgaagaggttaagtctcattttgggttcaaa
aaatatgttgtatcatctttagtactagtgtatggactaattaaggttctcacgtggatc
ttccgtcaatgggtgtattccagcttgaatccgttctccaaaaaatcttcattactgaac
agagcagttgcctcctgtggtgagaagaatgtgaaagtttttggtttttttcatccgtat
tgtaatgctggtggtggtggggaaaaagtgctctggaaagctgtagatatcactttgaga
aaagatgctaagaacgttattgtcatttattcaggggattttgtgaatggagagaatgtt
actccggagaatattctaaataatgtgaaagcgaagttcgattacgacttggattcggat
agaatatttttcatttcattgaagctaagatacttggtggattcttcaacatggaagcat
ttcacgttgattggacaagcaattggatcaatgattctcgcatttgaatccattattcag
tgtccacctgatatatggattgatacaatggggtaccctttcagctatcctattattgct
aggtttttgaggagaattcctatcgtcacatatacgcattatccgataatgtcaaaagac
atgttaaataagctgttcaaaatgcccaagaagggtatcaaagtttacggtaaaatatta
tactggaaagtttttatgttaatttatcaatccattggttctaaaattgatattgtaatc
acaaactcaacatggacaaataaccacataaagcaaatttggcaatccaatacgtgtaaa
attatatatcctccatgctctactgagaaattagtagattggaagcaaaagtttggtact
gcaaagggtgagagattaaatcaagcaattgtgttggcacaatttcgtcctgagaaacgt
cataagttaatcattgagtcctttgcaactttcttgaaaaatttaccggattctgtatcg
ccaattaaattgataatggcggggtccactagatccaagcaagatgaaaattatgttaaa
agtttacaagactggtcagaaaatgtattaaaaattcctaaacatttgatatcattcgaa
aaaaatctgcccttcgataagattgaaatattactaaacaaatctactttcggtgttaat
gccatgtggaatgagcactttggaattgcagttgtagagtatatggcttccggtttgatc
cccatagttcatgcctcggcgggcccattgttagatatagttactccatgggatgccaac
gggaatatcggaaaagctccaccacaatgggagttacaaaagaaatattttgcaaaactc
gaagatgatggtgaaactactggatttttctttaaagagccgagtgatcctgattataac
acaaccaaagatcctctgagataccctaatttgtccgaccttttcttacaaattacgaaa
ctggactatgactgcctaagggtgatgggcgcaagaaaccagcagtattcattgtataaa
ttctctgatttgaagtttgataaagattgggaaaactttgtactgaatcctatttgtaaa
ttattagaagaggaggaaaggggctga

DBGET integrated database retrieval system