KEGG   Saccharomyces cerevisiae (budding yeast): YNL055CHelp
Entry
YNL055C           CDS       T00005                                 

Gene name
POR1, OMP2
Definition
(RefSeq) porin POR1
  KO
K15040  voltage-dependent anion channel protein 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sce03029]
    YNL055C (POR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sce04040]
    YNL055C (POR1)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    YNL055C (POR1)
Ion channels [BR:sce04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   YNL055C (POR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porin_3
Motif
Other DBs
NCBI-GeneID: 855669
NCBI-ProteinID: NP_014343
SGD: S000005000
UniProt: P04840
Position
XIV:complement(517994..518845)
Genome map
AA seq 283 aa AA seqDB search
MSPPVYSDISRNINDLLNKDFYHATPAAFDVQTTTANGIKFSLKAKQPVKDGPLSTNVEA
KLNDKQTGLGLTQGWSNTNNLQTKLEFANLTPGLKNELITSLTPGVAKSAVLNTTFTQPF
FTARGAFDLCLKSPTFVGDLTMAHEGIVGGAEFGYDISAGSISRYAMALSYFAKDYSLGA
TLNNEQITTVDFFQNVNAFLQVGAKATMNCKLPNSNVNIEFATRYLPDASSQVKAKVSDS
GIVTLAYKQLLRPGVTLGVGSSFDALKLSEPVHKLGWSLSFDA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctccagtttacagcgatatctccagaaatatcaatgacctattgaacaaggat
ttctatcatgctaccccagctgcctttgatgtgcaaacaacaaccgccaatggcattaag
ttctcattgaaggctaaacagcctgtcaaagacggtccactgtctactaacgtggaagca
aagttgaatgacaagcaaaccggcttgggtctaactcaaggctggtctaacacaaacaac
ttgcaaaccaaattagagtttgccaacttgacccctggtctaaagaacgaattgatcact
tctttgactccaggcgtcgccaagtccgccgtcttaaacactacgttcacacaacctttc
ttcaccgcaagaggtgcctttgacttgtgtttgaagtcaccaacatttgttggtgactta
actatggcccacgaaggtattgttggtggcgcagagtttggttacgatatcagcgccggt
tccatttctcgttatgccatggctttaagttatttcgccaaagactactccttgggcgct
acattgaacaacgagcaaataactaccgttgacttcttccaaaacgtcaacgccttttta
caggtcggtgctaaggctacaatgaactgcaaactacctaactccaatgtcaacatcgaa
ttcgccactagatatttgcctgatgcatcttcccaagttaaggctaaggtgtccgattcc
ggtattgtcactttggcttacaagcaattgttaagacctggcgtcactctgggtgtcggt
tcctctttcgatgctttgaagttgtctgaacctgttcacaagctaggttggtctttgtcc
ttcgacgcttga

DBGET integrated database retrieval system