KEGG   Saccharomyces cerevisiae (budding yeast): YNL083WHelp
Entry
YNL083W           CDS       T00005                                 

Gene name
SAL1
Definition
(RefSeq) Ca(2+)-binding ATP:ADP antiporter SAL1
  KO
K14684  solute carrier family 25 (mitochondrial phosphate transporter), member 23/24/25/41
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YNL083W (SAL1)
Transporters [BR:sce02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   YNL083W (SAL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mito_carr EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 EF-hand_8 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 855641
NCBI-ProteinID: NP_014316
SGD: S000005027
UniProt: D6W196
Position
XIV:471377..472861
Genome map
AA seq 494 aa AA seqDB search
MLLKNCETDKQRDIRYACLFKELDVKGNGQVTLDNLISAFEKNDHPLKGNDEAIKMLFTA
MDVNKDSVVDLSDFKKYASNAESQIWNGFQRIDLDHDGKIGINEINRYLSDLDNQSICNN
ELNHELSNEKMNKFSRFFEWAFPKRKANIALRGQASHKKNTDNDRSKKTTDSDLYVTYDQ
WRDFLLLVPRKQGSRLHTAYSYFYLFNEDVDLSSEGDVTLINDFIRGFGFFIAGGISGVI
SRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAVKSLYRQGG
IKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFSTYIAGGLAGMA
AQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGGQIILQRCHSRYSGHISL
CCIRFGDFFCLKKMVYCQTGKDPEPTTRSGHSKQPGCTSNGCIQWNCRSFCCLSNQSFKN
KTTSPRNICTSLCV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgaaaaattgcgagacggacaagcagcgagatatacggtatgcgtgtttgttc
aaggaacttgatgttaagggaaatggtcaagttactctagataatctgataagtgctttt
gagaagaacgaccatccgctcaagggaaatgatgaggcaatcaaaatgctgtttactgca
atggatgttaacaaggactctgtagttgatttaagcgatttcaagaagtatgcttccaat
gccgaatctcaaatttggaacggcttccagaggatagatttagatcatgacggtaagatt
ggcattaacgaaataaataggtatttgtcagacctcgacaaccagagcatatgtaataat
gaacttaatcatgaactttcaaatgaaaagatgaacaaattctcgaggttttttgaatgg
gcgtttccaaagagaaaagccaacattgcgctacgaggccaggctagccacaaaaagaat
actgataatgatcggtcaaagaaaaccaccgactcagatttatacgttacatatgatcaa
tggagagactttttgctgctggtaccgagaaagcagggttcgagacttcatactgcttat
tcctatttttacctattcaacgaagatgtcgatctgtcctcagagggagatgttactctc
ataaacgatttcattcgcgggttcgggttttttattgctggtggtatttcaggtgttatt
tcaaggacttgtaccgcgccatttgatagactgaaagtgtttctcatcgcaagaacggat
ctatcctcgatcttgttaaattcaaaaacagatctccttgctaaaaaccccaatgctgac
ataaacaagatatcatctccattagcaaaggctgtcaaaagcttatataggcaaggcggg
ataaaggctttttatgttgggaacggtttaaacgtcatcaaagtttttccagaaagttcg
ataaagtttggttctttcgaggtcaccaagaaaataatgaccaaattagaaggctgccgc
gacacaaaagatctttcaaagttctctacttacattgctggtggtttagctggtatggca
gctcagttttccgtttatcctatagatactttgaaattcagggtgcagtgcgctcctttg
gacacaaagttgaaggggaataatttgctctttcagactgcaaaagatatgtttcgagag
ggggggggtcagattattttacagaggtgtcacagtcggtatagtgggcatatttcccta
tgctgcattagatttggggactttttctgccttaaaaaaatggtatattgccaaacaggc
aaagaccctgaacctaccacaagatcaggtcactctaagcaacctggttgtacttccaat
gggtgcattcagtggaactgtaggagcttctgttgtttatccaatcaatcttttaagaac
aagactacaagcccaaggaacatatgcacatccttatgtgtataa

DBGET integrated database retrieval system