KEGG   Saccharomyces cerevisiae (budding yeast): YNL088W
Entry
YNL088W           CDS       T00005                                 

Gene name
TOP2, TOR3, TRF3
Definition
(RefSeq) DNA topoisomerase 2
  KO
K03164  DNA topoisomerase II [EC:5.6.2.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YNL088W (TOP2)
   03036 Chromosome and associated proteins [BR:sce03036]
    YNL088W (TOP2)
Enzymes [BR:sce01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     YNL088W (TOP2)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Topoisomerases
   YNL088W (TOP2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    YNL088W (TOP2)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    YNL088W (TOP2)
SSDB
Motif
Pfam: DNA_topoisoIV TOPRIM_C DNA_gyraseB HATPase_c Toprim
Other DBs
NCBI-GeneID: 855636
NCBI-ProteinID: NP_014311
SGD: S000005032
UniProt: P06786
Structure
PDB: 

Position
XIV:457704..461990
AA seq 1428 aa
MSTEPVSASDKYQKISQLEHILKRPDTYIGSVETQEQLQWIYDEETDCMIEKNVTIVPGL
FKIFDEILVNAADNKVRDPSMKRIDVNIHAEEHTIEVKNDGKGIPIEIHNKENIYIPEMI
FGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILETADLNVGQKYVQKWENNMSIC
HPPKITSYKKGPSYTKVTFKPDLTRFGMKELDNDILGVMRRRVYDINGSVRDINVYLNGK
SLKIRNFKNYVELYLKSLEKKRQLDNGEDGAAKSDIPTILYERINNRWEVAFAVSDISFQ
QISFVNSIATTMGGTHVNYITDQIVKKISEILKKKKKKSVKSFQIKNNMFIFINCLIENP
AFTSQTKEQLTTRVKDFGSRCEIPLEYINKIMKTDLATRMFEIADANEENALKKSDGTRK
SRITNYPKLEDANKAGTKEGYKCTLVLTEGDSALSLAVAGLAVVGRDYYGCYPLRGKMLN
VREASADQILKNAEIQAIKKIMGLQHRKKYEDTKSLRYGHLMIMTDQDHDGSHIKGLIIN
FLESSFPGLLDIQGFLLEFITPIIKVSITKPTKNTIAFYNMPDYEKWREEESHKFTWKQK
YYKGLGTSLAQEVREYFSNLDRHLKIFHSLQGNDKDYIDLAFSKKKADDRKEWLRQYEPG
TVLDPTLKEIPISDFINKELILFSLADNIRSIPNVLDGFKPGQRKVLYGCFKKNLKSELK
VAQLAPYVSECTAYHHGEQSLAQTIIGLAQNFVGSNNIYLLLPNGAFGTRATGGKDAAAA
RYIYTELNKLTRKIFHPADDPLYKYIQEDEKTVEPEWYLPILPMILVNGAEGIGTGWSTY
IPPFNPLEIIKNIRHLMNDEELEQMHPWFRGWTGTIEEIEPLRYRMYGRIEQIGDNVLEI
TELPARTWTSTIKEYLLLGLSGNDKIKPWIKDMEEQHDDNIKFIITLSPEEMAKTRKIGF
YERFKLISPISLMNMVAFDPHGKIKKYNSVNEILSEFYYVRLEYYQKRKDHMSERLQWEV
EKYSFQVKFIKMIIEKELTVTNKPRNAIIQELENLGFPRFNKEGKPYYGSPNDEIAEQIN
DVKGATSDEEDEESSHEDTENVINGPEELYGTYEYLLGMRIWSLTKERYQKLLKQKQEKE
TELENLLKLSAKDIWNTDLKAFEVGYQEFLQRDAEARGGNVPNKGSKTKGKGKRKLVDDE
DYDPSKKNKKSTARKGKKIKLEDKNFERILLEQKLVTKSKAPTKIKKEKTPSVSETKTEE
EENAPSSTSSSSIFDIKKEDKDEGELSKISNKFKKISTIFDKMGSTSATSKENTPEQDDV
ATKKNQTTAKKTAVKPKLAKKPVRKQQKVVELSGESDLEILDSYTDREDSNKDEDDAIPQ
RSRRQRSSRAASVPKKSYVETLELSDDSFIEDDEEENQGSDVSFNEED
NT seq 4287 nt   +upstreamnt  +downstreamnt
atgtcaactgaaccggtaagcgcctctgataaatatcagaaaatttctcaactggaacat
atcttaaaaagaccagacacttatatcggttctgttgaaactcaagagcagctgcaatgg
atatacgatgaagagaccgattgcatgattgaaaaaaatgtcacaattgtaccagggttg
ttcaaaatctttgatgaaatcttagtcaatgcggcagataataaagttcgtgatccatcg
atgaaacgaatcgatgtaaacatacatgctgaggaacatactatagaagtgaaaaatgat
ggaaaaggtattcccatagagattcataacaaggagaatatttatattcctgaaatgata
tttggtcatttgttgacatcatccaattatgatgatgatgagaagaaagtcactggtggt
agaaacggttatggtgctaagctttgtaatatattttccactgaattcatattagaaact
gcagatctaaatgttggccagaaatatgttcaaaaatgggaaaataacatgagcatttgc
caccccccaaaaataacatcttacaagaagggtccatcatatacaaaggtgacatttaag
ccggatttaaccagattcggaatgaaagagctagataatgatatcttaggagtgatgcga
agaagagtttatgatatcaatggttctgttcgtgacattaatgtctatctgaatggcaag
tccttaaagataagaaatttcaaaaattatgttgaactctacttgaaatcactcgaaaaa
aaaagacaactagataacggtgaggacggtgccgctaagtctgatatcccgactattctt
tatgagagaataaacaacagatgggaagttgcttttgcggtttctgatatctcttttcaa
caaatttcttttgtgaattccattgcaactaccatgggtggtacccatgtcaattacata
acagaccaaattgtaaaaaaaatttcagaaattttgaagaaaaagaagaaaaaaagtgtg
aagtcttttcagattaaaaataatatgttcattttcattaattgtttgattgagaatcct
gcatttacctcacaaacaaaagagcaactgacaacaagagtcaaagattttgggtcccgt
tgtgagattcctcttgaatatattaataagattatgaaaactgatttggctacaagaatg
tttgaaattgccgacgcaaatgaagaaaatgcgctaaagaagtctgatggtacaaggaaa
agcagaattactaattaccctaaactggaagatgccaacaaagccggtacaaaagaaggc
tataaatgtactttagttctgacagaaggggattccgccttgtcattagctgttgcaggt
ttagctgttgttggtagagattattatggttgttatccacttcgtggtaaaatgctgaat
gttagagaagctagtgctgatcagatactaaaaaacgcggaaattcaagccattaaaaaa
attatggggttacaacatcgcaagaaatatgaagatacaaaatctttaagatatgggcat
cttatgatcatgaccgatcaagatcatgatggttcgcatattaaaggtttaattataaac
tttttagaaagctcatttcctggtcttttggatatccaaggtttcttacttgaattcata
actccgatcatcaaagtttccatcactaaaccaacaaaaaacactattgcattctacaat
atgccggactatgaaaaatggagagaggaagaatcgcacaaatttacttggaagcagaag
tattataaaggattagggacttctctagcacaagaagtccgagaatatttttcgaacttg
gacagacatttgaaaatattccattctttgcagggtaatgataaagattacattgattta
gctttctccaagaaaaaggcagatgaccgtaaagaatggctgagacaatacgaacctggt
actgttttagaccctactttaaaagagattccaattagcgacttcattaataaggaatta
atccttttttctttggccgataatatacggtcgattcccaatgttttagatggatttaaa
cctggccaaagaaaagttctttatggttgtttcaaaaaaaatttaaagtcggaactgaaa
gtagctcaacttgcaccatacgtgagcgaatgtacggcatatcaccatggtgagcagtca
ttggcacaaactattattgggctagcccaaaactttgttgggtccaacaatatttacttg
ctattacctaacggtgctttcggtacaagagccactggtggtaaagatgcagcggcagcg
agatatatctacacagaattgaacaaattaactcgtaagatatttcaccctgctgatgat
ccattatacaaatatatacaagaagatgagaaaacagtggagccagagtggtatttacca
attcttcctatgattcttgttaacggtgctgagggtattggcactggctggagtacttac
attcctccattcaacccattggaaattataaagaatataagacatttaatgaacgacgag
gagcttgagcaaatgcatccgtggtttaggggatggaccggtactattgaagaaattgag
cctctgcgttacagaatgtacggtaggattgaacaaattggagataacgtcttagaaata
actgagttgccagccagaacttggacatcgactataaaggagtacttacttttaggttta
agcggtaacgataaaataaaaccctggatcaaagatatggaggagcagcacgatgataac
atcaaattcataatcacgctatcacctgaggaaatggctaaaacaaggaaaataggtttt
tatgaaagatttaaactaatttcgcctataagtttgatgaatatggtcgcatttgatcct
cacgggaaaatcaagaagtacaattccgtgaatgaaatattaagcgaattttactacgtc
agactagaatactatcaaaaaagaaaagaccatatgagcgaaaggttacagtgggaggta
gagaaatactctttccaagtaaaatttattaaaatgattattgaaaaggagttaacagtc
accaataagcctaggaacgctattatccaagaacttgagaatttagggttccccagattt
aataaggaaggtaaaccatattatggaagtcctaacgatgagatagctgaacaaattaac
gacgtaaaaggcgcaacttctgatgaagaagatgaagaaagttcacacgaagatactgaa
aatgttataaatggtcctgaagaactatatggcacatatgaatatttattaggaatgaga
atatggtcattgaccaaggaaagatatcaaaagctgttgaaacaaaaacaagaaaaggag
acagagttggaaaacttgttaaaactttccgcgaaagatatatggaacactgacttgaag
gcttttgaggtgggatatcaagaatttttgcaacgagatgcagaagctcgcggtggtaat
gttcccaataaagggagcaaaacgaaaggtaaaggaaaaagaaagcttgttgacgacgaa
gactacgacccatcaaaaaaaaacaagaaaagtactgctagaaagggcaaaaaaattaag
ttagaggataagaattttgaaaggattttgttagaacaaaaactagtaaccaaaagcaag
gcgcctacaaagattaaaaaagagaaaacgccttctgtttcagaaacaaaaacagaagaa
gaagagaatgctccttcttccacgagttcttcttctattttcgacataaagaaagaagat
aaagatgagggcgaactgagtaagatttcgaacaagtttaaaaaaattagcacgattttt
gacaaaatgggttctacttccgctacatcgaaggaaaatacaccagaacaggacgatgta
gccactaaaaaaaatcaaacaaccgctaaaaaaacagctgtaaaacctaaattggccaag
aagccagtcaggaaacaacaaaaagttgtggaactatctggtgaaagcgacctagaaatt
ttagattcatacactgatcgggaagatagcaataaagatgaagatgatgctataccacaa
cgatcaaggagacaaagatcgtcgagagctgcgtcggttcctaagaaatcttacgttgaa
actttagaattatctgacgacagtttcatcgaagatgatgaagaggaaaaccaaggatca
gatgtttcgttcaatgaagaggattga

DBGET integrated database retrieval system