KEGG   Saccharomyces cerevisiae (budding yeast): YNL097CHelp
Entry
YNL097C           CDS       T00005                                 

Gene name
PHO23
Definition
(RefSeq) Pho23p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ING PHD PHD_2 Elongin_A zf-HC5HC2H
Motif
Other DBs
NCBI-GeneID: 855626
NCBI-ProteinID: NP_014302
SGD: S000005041
UniProt: P50947
Position
XIV:complement(441366..442358)
Genome map
AA seq 330 aa AA seqDB search
MSSPANLFPGLNDITDVLEEFPLATSRYLTLLHEIDAKCVHSMPNLNERIDKFLKKDFNK
DHQTQVRLLNNINKIYEELMPSLEEKMHVSSIMLDNLDRLTSRLELAYEVAIKNTEIPRG
LRLGVDNHPAMHLHHELMEKIESKSNSKSSQALKSESRREAMAANRRQGEHYSASTHQQD
DSKNDANYGGSRHESQDHTGNNTNSRKRANAANTNNADPETKKRKRRVATTAVSPSTIST
ATAVNNGRIGTSTASRGVSSVGNSNNSRISRPKTNDYGEPLYCYCNQVAYGEMVGCDGAD
CELEWFHLPCIGLETLPKGKWYCDDCKKKL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaccagcgaacctattccctggattaaacgacataactgacgtgctggaggaa
ttcccactggccacctccagatatttaacattactacacgaaatagatgcaaaatgtgtg
cattctatgccgaatttgaacgagaggatagataagttcttgaagaaagacttcaataaa
gatcaccaaacacaagtaagactgctcaataatatcaacaagatttatgaagaactgatg
ccatcgctggaggagaaaatgcatgtctcatccattatgctggataatctagacagattg
acgtcccggttagaattggcgtatgaagtcgcaatcaagaacacagaaattcctagaggt
ttaagactgggtgtggacaaccatccagcaatgcacctccatcatgaactaatggaaaaa
atagagagcaaatcaaacagcaaatcgtcgcaggcactgaagagcgaatcaagaagagaa
gccatggctgccaacaggaggcagggcgaacattactccgccagcacacaccaacaagac
gactcaaagaacgacgcaaactacggaggcagcaggcacgagagccaagaccacactggt
aacaacacaaactcaagaaaaagagccaacgctgccaataccaacaacgccgatccagag
accaaaaaacgcaagaggagagttgccaccacagccgtttcaccaagcactatcagcacg
gcaactgccgtcaataatggcaggataggtacatctacagcgtccaggggagttagcagc
gtcggaaacagcaacaacagcaggatatcaagaccaaaaaccaacgactacggcgaaccg
ctctactgctactgtaaccaagtggcatacggggaaatggtggggtgtgatggcgcagac
tgtgagctagaatggttccatttgccatgtattggactcgaaactctacctaagggcaag
tggtattgcgacgactgcaaaaaaaaactgtga

DBGET integrated database retrieval system