KEGG   Saccharomyces cerevisiae (budding yeast): YNL101WHelp
Entry
YNL101W           CDS       T00005                                 

Gene name
AVT4
Definition
(RefSeq) Avt4p
  KO
K14209  solute carrier family 36 (proton-coupled amino acid transporter)
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YNL101W (AVT4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YNL101W (AVT4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YNL101W (AVT4)
Membrane trafficking [BR:sce04131]
 Autophagy
  Other autophagy associated proteins
   Others
    YNL101W (AVT4)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC36: Proton-coupled amino acid transporter
   YNL101W (AVT4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aa_trans
Motif
Other DBs
NCBI-GeneID: 855622
NCBI-ProteinID: NP_014298
SGD: S000005045
UniProt: P50944
Position
XIV:434999..437140
Genome map
AA seq 713 aa AA seqDB search
MVTNNGDGEHLGIRRNGNLRHPSNNMKIPRRAQSTVLNSNPFYSRKYSMSTLTPRDICRS
VDSRVFVDMSSPNFQTLEDPHRDEIINSVRLNYLNSSKRSSVSHGNEAIPRVNPTKNSSA
STIAAANVDSDDDETNLSSAGGDITHDIYKLVKAEDPKRLRRPRSMENVTPKIEHHTKLS
SASGLNVPGGFRREFIVNKKRQEHQLNDSASSDFTSHESDSINQSSPSSNQDIDKVPFLT
RNFLEFLYVFGHFAGESFEDDFIPDSSNMMIRGEDERSALLSRPDHMKVLPSAKGTTSTK
KVFLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLAFFGIYSYWCYYILVQAKSSCGVSSF
GDIGLKLYGPWMRIIILFSLVITQVGFSGAYMIFTAKNLQAFLDNVFHVGVLPLSYLMVF
QTIIFIPLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAKRLFFDLMGTPAMGVVYGLN
ADRWTLFIGTAIFAFEGIGLIIPVQDSMRNPEKFPLVLALVILTATILFISIATLGYLAY
GSNVQTVILLNLPQSNIFVNLIQLFYSIAIMLSTPLQLFPAIKIIENKFFPKFTKIYVKH
DDLTTRVELRPNSGKLNWKIKWLKNFIRSIIVIIVVSIAYFGSDNLDKFVSVIGSLACIP
LVYIYPSMLHLRGNSLPETKGEFWRFKPMLDTILIFFGIASMLYTSYQSIFGV
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggtcactaacaatggagatggtgagcaccttgggatccgaagaaacggaaatttaagg
catccttccaataatatgaaaattcccagaagggctcaatcaacagttctcaattcaaac
ccattttatagtaggaagtattctatgtctaccttaacgccgagggatatatgtcgaagc
gttgattctagagtatttgtggatatgtcttctcccaattttcagactctggaggatccc
cacagagatgagattataaacagtgtacggcttaactacttgaacagtagcaaaagaagt
tccgtctctcatggaaatgaagcaatccctagggttaatccgactaagaattcttcagca
agtaccatagctgcagcaaatgttgatagtgatgacgatgagactaacctgagtagcgct
ggaggcgacataacgcatgatatttacaagttggttaaagcagaggatcctaaacggctc
agacgccctcggtccatggaaaatgtaacacctaaaattgagcaccatactaaattgtca
tcagcaagtggtttaaatgtccccggtggcttcagaagggaatttattgtcaacaaaaaa
aggcaagaacatcaattaaatgattccgctagctcagacttcacttcgcatgaaagcgat
tcgattaaccagtcatctccatcttctaaccaagatatcgataaggtcccctttttaaca
agaaactttttggaatttctatacgtgtttggacattttgctggtgaatccttcgaggat
gattttatccctgatagctcaaacatgatgatacgcggagaagatgaaaggagtgcattg
ctgtctcggcctgaccatatgaaagtattaccttcagccaaaggtacgacttcgacaaag
aaggtttttttgatattgcttaaatctttcattggaactggcgttttatttttacctaat
gcctttcataatggtggtttgtttttctcagtaagtatgctggccttttttggaatttat
tcatactggtgttactacatattggtgcaggccaaatcttcatgcggtgtatcctccttt
ggtgatattggtttaaaactgtatggaccttggatgagaataataattcttttctcccta
gtaataactcaagttggattctctggagcttatatgatatttactgcaaaaaatttacaa
gcttttcttgataacgtattccatgtgggcgtcctacctttatcttacctgatggtcttt
caaacgatcatttttattccactttcgtttattagaaacatttcgaaattgtcactacca
tctttactagcaaattttttcatcatggctggtttagtcattgtcattatttttacagcc
aaaaggttgttttttgacctgatggggaccccagcaatgggtgtcgtctatggcttaaat
gcagaccgttggacgctgtttatcgggacggcaatatttgctttcgaaggaatcgggtta
attattcctgttcaagactcaatgagaaatcctgaaaaatttcctttagtacttgctttg
gtgattctaacggcaaccatacttttcatttccatagctacattgggatatttggcatac
ggctcaaatgttcaaacggttatactgttgaacttacctcaaagtaacatttttgtaaac
ttaatccagctgttctattccatcgcaattatgttgtccacacctttgcagttgtttcca
gctattaaaattattgaaaataagttttttccaaagttcactaaaatatatgtcaagcac
gatgatctaacaacaagagtcgaattacgtcctaattcaggaaagctgaactggaaaatt
aaatggctgaagaactttattcgttctataatcgtaatcattgttgtatcaattgcttac
tttgggtctgataatttagacaagttcgtttcagttataggatccctcgcctgtattcct
ttggtatatatatacccatcgatgctgcatttacggggcaatagccttccagagactaaa
ggggaattttggagattcaaaccaatgttagataccattttaattttcttcggtattgca
agcatgctttatacgtcttaccagagtatattcggtgtctag

DBGET integrated database retrieval system