KEGG   Saccharomyces cerevisiae (budding yeast): YNL138W
Entry
YNL138W           CDS       T00005                                 

Gene name
SRV2, CAP
Definition
(RefSeq) adenylate cyclase-binding protein
  KO
K17261  adenylyl cyclase-associated protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YNL138W (SRV2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YNL138W (SRV2)
Membrane trafficking [BR:sce04131]
 Others
  Actin-binding proteins
   Others
    YNL138W (SRV2)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YNL138W (SRV2)
SSDB
Motif
Pfam: CAP_C CAP_N
Other DBs
NCBI-GeneID: 855584
NCBI-ProteinID: NP_014261
SGD: S000005082
UniProt: P17555
Structure
PDB: 
1K4Z 1KQ5

Position
XIV:366741..368321
AA seq 526 aa
MPDSKYTMQGYNLVKLLKRLEEATARLEDVTIYQEGYIQNKLEASKNNKPSDSGADANTT
NEPSAENAPEVEQDPKCITAFQSYIGENIDPLVELSGKIDTVVLDALQLLKGGFQSQLTF
LRAAVRSRKPDYSSQTFADSLRPINENIIKLGQLKESNRQSKYFAYLSALSEGAPLFSWV
AVDTPVSMVTDFKDAAQFWTNRILKEYRESDPNAVEWVKKFLASFDNLKAYIKEYHTTGV
SWKKDGMDFADAMAQSTKNTGATSSPSPASATAAPAPPPPPPAPPASVFEISNDTPATSS
DANKGGIGAVFAELNQGENITKGLKKVDKSQQTHKNPELRQSSTVSSTGSKSGPPPRPKK
PSTLKTKRPPRKELVGNKWFIENYENETESLVIDANKDESIFIGKCSQVLVQIKGKVNAI
SLSETESCSVVLDSSISGMDVIKSNKFGIQVNHSLPQISIDKSDGGNIYLSKESLNTEIY
TSCSTAINVNLPIGEDDDYVEFPIPEQMKHSFADGKFKSAVFEHAG
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgcctgactctaagtacacaatgcaaggttataaccttgttaagctattaaaaaggcta
gaagaagccactgcaagattagaggatgtcaccatctatcaagaaggttatattcagaat
aaattggaggcatctaaaaataacaagccttccgactccggggccgatgcgaatactacg
aatgaaccttctgcagaaaatgctcctgaagtagaacaagatccgaaatgcataactgcg
ttccaatcttacatcggtgagaatattgatccgctggtagaattatcaggaaagatcgac
acggtggtcttagatgctttgcagttgctaaagggaggctttcaatcgcaattgactttt
ttaagagctgctgtgagatcaagaaaaccggattattcttctcaaactttcgctgattct
ttaagacctatcaacgaaaatattataaagctgggtcaattgaaggaatcaaaccgtcaa
agcaaatacttcgcatatttgagcgctttatctgagggtgctcctttgttctcctgggtt
gcagtggacactcccgtgtctatggtcacagatttcaaggacgcagcacagttttggact
aatagaattttgaaagaatacagagagtctgatcctaatgctgttgaatgggttaagaaa
tttttggcctctttcgataatttgaaagcctacattaaagagtatcatactactggggtt
tcctggaaaaaagacggtatggattttgctgacgcgatggcacaatcaacgaagaataca
ggtgctacttcatctccttcgccagcaagtgctacagcggctccagcaccaccacctcct
ccaccagccccaccagcttccgtctttgaaatctctaatgatacaccagcaacgagtagt
gatgctaacaaaggcggtattggcgcggtcttcgccgaactaaatcagggtgaaaatatc
actaagggtttgaaaaaagtagacaaatcccaacaaactcacaaaaatcctgaattacgt
caatcctctacagtttcttccacaggaagtaaatccggtccaccaccaaggccaaaaaag
ccatcaacattgaaaactaagaggcctcctagaaaggaattggtaggaaacaaatggttt
attgagaattacgaaaatgaaactgaatctctggttattgatgcaaataaagatgagtct
atcttcataggtaaatgttctcaagttcttgttcaaataaaaggaaaagttaacgctatc
tcgttgagtgaaactgagtcatgcagtgttgttcttgattctagcatttccggtatggat
gtcatcaaatccaacaagtttggcattcaagttaaccattccctacctcaaatctccatt
gataaatctgacggcggtaacatctatttatccaaggaatccttgaatactgaaatctac
acctcgtgctcaactgctattaacgtcaacttaccaatcggcgaggacgatgattacgta
gaattcccaatccctgaacagatgaagcatagcttcgctgatggtaagttcaaatctgct
gttttcgaacatgctggttaa

DBGET integrated database retrieval system