KEGG   Saccharomyces cerevisiae (budding yeast): YNL142W
Entry
YNL142W           CDS       T00005                                 

Symbol
MEP2
Name
(RefSeq) ammonium permease MEP2
  KO
K03320  ammonium transporter, Amt family
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YNL142W (MEP2)
Transporters [BR:sce02000]
 Other transporters
  Pores ion channels [TC:1]
   YNL142W (MEP2)
SSDB
Motif
Pfam: Ammonium_transp
Other DBs
NCBI-GeneID: 855580
NCBI-ProteinID: NP_014257
SGD: S000005086
UniProt: P41948
Structure
PDB: 
5AEX

Position
XIV:357453..358952
AA seq 499 aa
MSYNFTGTPTGEGTGGNSLTTDLNTQFDLANMGWIGVASAGVWIMVPGIGLLYSGLSRKK
HALSLLWASMMASAVCIFQWFFWGYSLAFSHNTRGNGFIGTLEFFGFRNVLGAPSSVSSL
PDILFAVYQGMFAAVTGALMLGGACERARLFPMMVFLFLWMTIVYCPIACWVWNAEGWLV
KLGSLDYAGGLCVHLTSGHGGLVYALILGKRNDPVTRKGMPKYKPHSVTSVVLGTVFLWF
GWMFFNGGSAGNATIRAWYSIMSTNLAAACGGLTWMVIDYFRCGRKWTTVGLCSGIIAGL
VGITPAAGFVPIWSAVVIGVVTGAGCNLAVDLKSLLRIDDGLDCYSIHGVGGCIGSVLTG
IFAADYVNATAGSYISPIDGGWINHHYKQVGYQLAGICAALAWTVTVTSILLLTMNAIPF
LKLRLSADEEELGTDAAQIGEFTYEESTAYIPEPIRSKTSAQMPPPHENIDDKIVGNTDA
EKNSTPSDASSTKNTDHIV
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgtcttacaattttacaggtacgcctacaggcgaaggaacgggtggtaactcgttgaca
acagatttgaatacacaatttgacttggccaacatgggatggatcggtgtggcttcagca
ggtgtgtggattatggtcccaggtatcggtttattatattctggtttatccaggaaaaag
catgctttatccttgctttgggcctcgatgatggcttccgccgtgtgtattttccaatgg
tttttctggggatactcattagctttctcacacaacactagaggtaacggttttattggt
accttggaattctttgggtttcgtaacgttttaggagccccatctagtgtcagttctctt
cccgatatactgtttgccgtttaccaaggtatgtttgccgcagtcaccggtgccctaatg
ctaggtggtgcctgcgagagggcaaggttgtttcctatgatggtgttcttgtttttatgg
atgactattgtttattgtcctattgcatgctgggtctggaatgccgagggttggttggtc
aaattgggtagcttggactatgcaggtggtttatgtgtccatttaacatctggacatggt
ggtctagtttacgctttgatactgggtaagcgtaatgaccctgttacacgtaaagggatg
cccaagtacaaaccacattccgtcacctcggtggttttaggcacagtgttcttatggttt
ggttggatgttctttaacggaggctctgcaggtaatgcaactatacgagcatggtactct
attatgtccacaaacttagctgctgcttgcggtggcttgacatggatggttatcgattat
ttcagatgcggaagaaagtggactacagttggtttgtgttcaggtatcatcgctggccta
gtgggtatcaccccagccgccgggttcgtgccaatctggtcagccgttgtcattggtgtg
gttactggtgcaggatgtaaccttgctgttgacttaaagagtctattgcgcatcgatgat
ggtctagattgttactctatccatggtgtgggtggttgtattggttctgtattaactggt
atctttgctgcagactatgtaaatgccactgcaggctcttacattagtccaattgatggt
ggctggatcaatcatcactataaacaagttggttatcaattagcaggtatatgcgctgca
ctagcctggactgttactgtcacatctatcttgcttctaactatgaatgccattccattt
ttaaaactaagattaagtgctgatgaggaagaattaggtaccgacgctgctcaaattggt
gaatttacatacgaggaatccactgcttacatcccagaaccaatcagatctaaaacatcg
gcacaaatgccacctcctcatgaaaacattgatgataagattgtgggtaacacagacgca
gaaaagaattctacgccttccgacgcttcttctactaagaacactgaccatatagtataa

DBGET integrated database retrieval system