KEGG   Saccharomyces cerevisiae (budding yeast): YNL153CHelp
Entry
YNL153C           CDS       T00005                                 

Gene name
GIM3, PFD4
Definition
(RefSeq) tubulin-binding prefolding complex subunit GIM3
  KO
K09550  prefoldin subunit 4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sce03110]
    YNL153C (GIM3)
Chaperones and folding catalysts [BR:sce03110]
 Heat shock proteins
  GimC
   YNL153C (GIM3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prefoldin_2 Sipho_Gp157 UPF0054 DUF5408 ABC_tran_CTD PspB
Motif
Other DBs
NCBI-GeneID: 855569
NCBI-ProteinID: NP_014246
SGD: S000005097
UniProt: P53900
Position
XIV:complement(345669..346058)
Genome map
AA seq 129 aa AA seqDB search
MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLDDVSLEIELID
EDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLEDKQRDIDSRLDALKAILYAK
FGDNINLER
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggaactgttaccacagggacaaaggaacaacactcaggtaacgttcgaagatcagcaa
aagatcaacgagttttcgaagttgattatgcgtaaggacgccattgcgcaggaattgagt
ttacagagggaggagaaggagtacctcgatgatgtgtctctagaaattgaattgattgac
gaagatgagcccgtgcaatacaaggtgggcgacctctttatcttcatgaaacagagcaaa
gttaccgcacagctcgaaaaagacgcagaacgtctcgacaacaaaatagagactttagag
gacaagcaaagagacattgattcccgtcttgatgctctgaaggcgatcctgtatgctaaa
tttggtgataatatcaaccttgaacgttag

DBGET integrated database retrieval system