KEGG   Saccharomyces cerevisiae (budding yeast): YNL160WHelp
Entry
YNL160W           CDS       T00005                                 

Gene name
YGP1
Definition
(RefSeq) Ygp1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asparaginase MF_alpha_N
Motif
Other DBs
NCBI-GeneID: 855562
NCBI-ProteinID: NP_014239
SGD: S000005104
UniProt: P38616
Position
XIV:336545..337609
Genome map
AA seq 354 aa AA seqDB search
MKFQVVLSALLACSSAVVASPIENLFKYRAVKASHSKNINSTLPAWNGSNSSNVTYANGT
NSTTNTTTAESSQLQIIVTGGQVPITNSSLTHTNYTRLFNSSSALNITELYNVARVVNET
IQDKSSAGAVVVANAKSLEAVSFFFSIIFDTEKPIVVTEDSAYAIPVANNKNATKRGVLS
VTSDKLVYSGVFTPPTACSYGAGLPVAIVDDQDEVKWFFDASKPTLISSDSIIRKEYSNF
TTPYGLLENGVPIVPIVYDGGYSSSLIDSLSSAVQGLVVVSSGSTNSTSSTIESTEIPVV
YAQANTPLNFIDNKDVPKNAVGAGYLSPIKAQILLSIAAVNGVTSKSALESIFP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccaagttgttttatctgcccttttggcatgttcatctgccgtcgtcgcaagc
ccaatcgaaaacctattcaaatacagggctgttaaggcatctcacagtaagaatatcaac
tccactttgccggcctggaatgggtctaactctagcaatgttacctacgctaatggaaca
aacagtactaccaatactactactgccgaaagcagtcaattacaaatcattgtaacaggt
ggtcaagtaccaatcaccaacagttctttgacccacacaaactacaccagattattcaac
agttcttctgctttgaacattaccgaattgtacaatgttgcccgtgttgttaacgaaacg
atccaagataagtcatccgccggtgccgttgttgttgccaacgccaaatctttggaagct
gtctcattcttcttctctatcatttttgacaccgaaaagcctattgttgtcactgaagat
tccgcttatgccattccagtcgctaacaataagaacgctaccaaacgtggtgtcttgtcc
gtcacttctgacaaattagtgtactccggtgtcttcactccacctactgcttgttcttac
ggtgctggtttgcctgttgctatcgttgatgaccaagacgaagttaaatggttcttcgat
gcttctaagccaactttaatctcttctgactcgattatcagaaaggaatacagtaacttc
actactccttatggtctattagaaaacggtgttccaattgttccaattgtctatgacggt
ggttactcttccagtttgattgactccttgagttctgccgttcaaggtttggttgttgtt
tcttctggttctaccaactcaacctcatctactattgaaagcactgaaatcccagtcgta
tatgctcaagctaacactccattaaactttattgacaacaaagatgttccaaagaacgct
gtgggtgctggttacctatccccaattaaggcccaaatcttgttgtccattgctgccgtt
aatggtgtcacctccaagtccgctctggaaagcattttcccatga

DBGET integrated database retrieval system