KEGG   Saccharomyces cerevisiae (budding yeast): YNL161WHelp
Entry
YNL161W           CDS       T00005                                 

Gene name
CBK1
Definition
(RefSeq) serine/threonine protein kinase CBK1
  KO
K08286  protein-serine/threonine kinase [EC:2.7.11.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YNL161W (CBK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     YNL161W (CBK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Seadorna_VP7 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 855561
NCBI-ProteinID: NP_014238
SGD: S000005105
UniProt: P53894
Structure
PDB: 

Position
XIV:332597..334867
Genome map
AA seq 756 aa AA seqDB search
MYNSSTNHHEGAPTSGHGYYMSQQQDQQHQQQQQYANEMNPYQQIPRPPAAGFSSNYMKE
QGSHQSLQEHLQRETGNLGSGFTDVPALNYPATPPPHNNYAASNQMINTPPPSMGGLYRH
NNNSQSMVQNGNGSGNAQLPQLSPGQYSIESEYNQNLNGSSSSSPFHQPQTLRSNGSYSS
GLRSVKSFQRLQQEQENVQVQQQLSQAQQQNSRQQQQQLQYQQQQQQQQQQQHMQIQQQQ
QQQQQQQQSQSPVQSGFNNGTISNYMYFERRPDLLTKGTQDKAAAVKLKIENFYQSSVKY
AIERNERRVELETELTSHNWSEERKSRQLSSLGKKESQFLRLRRTRLSLEDFHTVKVIGK
GAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDSPWVVSLYYSFQ
DAQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKLGFIHRDIKPDN
ILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQQDEATNGISKPGTYNANTTDTANKRQ
TMVVDSISLTMSNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAI
MYECLIGWPPFCSETPQETYRKIMNFEQTLQFPDDIHISYEAEDLIRRLLTHADQRLGRH
GGADEIKSHPFFRGVDWNTIRQVEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAAKQ
REQMTKQGGSAPVKEDLPFIGYTYSRFDYLTRKNAL
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgtataatagcagcaccaatcatcatgagggtgcacctacttcaggacatggctattat
atgtcccaacaacaagaccaacagcatcaacaacaacaacaatacgccaacgaaatgaat
ccgtatcagcaaattcctagaccgcctgctgcaggatttagtagcaactacatgaaagag
caaggctctcatcaatcgttacaagagcatttacaacgtgagacaggtaaccttggcagc
ggttttacagacgttccagccctgaattatccagccacaccaccaccacataataattac
gcagcttcaaatcagatgatcaataccccaccgccgtcgatgggtggtctttatagacat
aataataattcccagagcatggttcagaacggtaatgggagtgggaatgcacaattaccc
caattatcaccgggccaatattctatagagtcagagtacaatcaaaatttaaatggcagt
tcttctagtagtccgttccaccaaccgcaaacgctacggagcaatgggtcatattcaagc
gggttaaggagtgtgaaaagcttccagaggttacaacaagaacaggaaaatgtccaagtt
cagcaacaactttcccaagcacagcaacaaaattcccggcaacaacagcaacaacttcaa
taccagcagcagcaacaacaacaacaacaacagcaacatatgcaaatacaacaacaacaa
cagcagcaacaacagcagcagcaatcacaatctcccgttcagagcggctttaataatggt
accatatcaaactatatgtactttgaaagacgaccagatttgttgactaaaggaacgcaa
gataaagcagcagctgtaaagttgaagattgagaacttttaccaatcctctgttaaatac
gccattgaaagaaatgaaagaagagtggagttagaaacagaactaacttctcataattgg
tcagaagaaaggaaatctaggcaattgagttctttgggtaaaaaagagtcacaattttta
aggctgcgtagaacgagattatcgttagaagatttccacactgtgaaagtcattggaaaa
ggggcatttggtgaagtcagactggttcagaagaaagacaccggaaaaatatatgcaatg
aaaactttattaaaatccgaaatgtacaaaaaggaccaattagcacacgtcaaggctgaa
agggatgttctggctggaagtgattctccatgggtggtttcgctatattactcattccaa
gatgctcaatacttatatttaatcatggaatttttgcccggtggtgatttgatgaccatg
ctaatcaggtggcaactatttacagaggatgttactagattttacatggctgagtgtatt
ttggccatcgaaaccattcataaattaggattcattcacagagatattaaaccagataat
attttgatcgatattagaggtcatataaaattatctgatttcgggttgtctacggggttc
cataaaactcacgactcaaactactataaaaagcttttgcaacaagatgaggcaactaat
ggtatttccaagccaggtacttacaatgcaaatacaaccgatactgcaaataaaaggcaa
acaatggttgtggattctattagtctaacaatgtcaaacaggcaacaaattcagacatgg
agaaaatcacgtcgtttaatggcatattctaccgtaggtacaccagattatattgctcct
gagatatttttataccaaggttatgggcaagagtgtgattggtggtcacttggagcaatt
atgtacgagtgtctgattggttggcctccattctgttccgaaactccacaggaaacgtac
agaaaaatcatgaattttgagcaaactctacaatttcctgatgatattcatatctcttat
gaagccgaagatctaatccgtcgactattaactcatgcagaccaaagacttggtagacat
ggtggtgcagatgaaataaaaagtcatccattttttcgcggtgttgattggaatacaatc
agacaagtagaagcaccgtatataccaaagttgagctccatcaccgatactaggttcttc
ccaaccgatgagttggagaatgttccagattccccagctatggcacaagctgccaaacaa
agggaacagatgacaaagcaaggtggaagtgcgccagtcaaggaagatttaccttttatt
ggctacacttactccagatttgactatttgacaagaaaaaatgcgttgtag

DBGET integrated database retrieval system