KEGG   Saccharomyces cerevisiae (budding yeast): YNL163CHelp
Entry
YNL163C           CDS       T00005                                 

Gene name
RIA1, EFL1
Definition
(RefSeq) GTPase RIA1
  KO
K14536  ribosome assembly protein 1 [EC:3.6.5.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    YNL163C (RIA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YNL163C (RIA1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     YNL163C (RIA1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  Pre-60S particles
   GTPases
    YNL163C (RIA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU EFG_C GTP_EFTU_D2 EFG_II EFG_IV MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 855558
NCBI-ProteinID: NP_014236
SGD: S000005107
UniProt: P53893
Position
XIV:complement(326741..330073)
Genome map
AA seq 1110 aa AA seqDB search
MPRVESETYKRLQNDPSCIRNICIVAHVDHGKTSLSDSLLASNGIISQRLAGKIRFLDAR
PDEQLRGITMESSAISLYFRVLRKQEGSDEPLVSEHLVNLIDSPGHIDFSSEVSAASRLC
DGAVVLVDVVEGVCSQTVTVLRQCWTEKLKPILVLNKIDRLITELQLTPQEAYIHLSKVI
EQVNSVIGSFFANERQLDDLFWREQLEKNENAEYIEKDDSGIYFNPTDNNVIFASAIDGW
GFNIGQLAKFYEQKLGAKRENLQKVLWGDFYMDPKTKKIINNKGLKGRSLKPLFTSLILE
NIWKIYQNIITSRDSEMVEKIAKTLNIKLLARDLRSKDDKQLLRTIMGQWLPVSTAVLLT
VIEKLPSPLESQTDRLNTILVSESDTAAMDPRLLKAMKTCDKEGPVSAYVSKMLSIPREE
LPVESKRIASSDELMERSRKAREEALNAAKHAGMVENMAMMDLNDNSKNTSDLYKRAKDT
VMTPEVGEQTKPKPSRNNDVFCVVSEPSSALDLEFEYEGEDDSDSQDNFGLDFVPTDIDP
NDPLSSMFEYEEEDPLLESIKQISEDVNDEVDDIFDEKEECLVAFARIYSGTLRVGQEIS
VLGPKYDPKCPEEHIETAIITHLYLFMGKELVPLDVCPSGNIVGIRGLAGKVLKSGTLIE
KGVQGVNLAGVNFHFTPIVRVAVEPANPVEMSKLVRGLKLLDQADPCVHTYVENTGEHIL
CTAGELHLERCLKDLTERFAGIEITHSEPAIPYRETFLSASDMNPPQNSQLGRGVHELLL
SQYKITFRTFPLSGKVTDFLSQHQNSIKNILKTSTSSMDPVIESTGSSFLDKKSLLVAFE
EVINQEEKSRELLSGFKVKLAGFGPSRVGCNILLSQDNLLGSLFEGTPAAFEYSDSIKNG
FQLAVSEGPLANEPVQGMCVLVESVHKMSQDEIESIEDPRYQQHIVDLSGRLITSTRDAI
HEAFLDWSPRIMWAIYSCDIQTSVDVLGKVYAVILQRHGKIISEEMKEGTPFFQIEAHVP
VVEAFGLSEDIRKRTSGAAQPQLVFSGFECIDLDPFWVPTTEEELEELGDTADRENIARK
HMNAIRRRKGLFIEEKVVENAEKQRTLKKN
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atgcctagagtggaatcggagacttacaaacgtctgcaaaatgacccttcctgtataaga
aatatatgtattgttgctcatgttgatcacggtaaaacttcactttcagattctcttttg
gcttcgaatggtattatatcacaaaggcttgccggcaaaattcgattcttagatgccagg
cctgacgaacaactacgtggtatcacaatggaatcatcggctatctctttatattttagg
gtattgcgtaaacaagaaggttccgatgagcctcttgtaagcgagcatctagtaaactta
attgattccccaggtcacattgatttttcaagtgaggtcagtgcagcttcaagactatgt
gatggtgctgtcgtactggttgatgtcgtagagggggtatgctcgcaaaccgtcacagtg
ttgagacaatgttggacggagaagctgaagcccattttagtattgaataagattgataga
ttgatcacagaactacaactaactccccaagaagcttatattcacttgtccaaagtcatt
gaacaagtcaactcagttatcgggtcctttttcgcaaacgagagacaattggatgattta
ttttggagggagcaattagaaaagaacgaaaacgcggaatatattgaaaaggatgattcg
ggtatttactttaaccctactgataacaacgttatttttgcttccgcaattgatggttgg
ggtttcaacatcggtcaattggccaaattttacgaacaaaaattaggcgctaaaagggaa
aacctacagaaagttttatggggtgatttctatatggatcccaagacaaaaaaaattatt
aacaataaaggccttaagggaagatccctgaaaccccttttcacatcgctaatcctcgaa
aatatatggaaaatttatcaaaacataatcacatcgagagattctgaaatggtcgaaaaa
atagcaaaaactttaaatattaagctacttgcacgtgatctaaggtcgaaggacgataaa
caattgttaagaactatcatgggtcaatggctacccgtcagcacagcagtattgttaaca
gttattgaaaaattaccttcacctttggaatcacaaaccgatcgtttgaacactattttg
gtctccgaatccgacacagcagccatggatccaagacttctgaaagccatgaagacatgt
gataaagaaggaccagttagtgcatacgtatctaagatgctttcaattcctagagaagaa
ttacctgttgaatctaagaggatagcatcttcggatgagctgatggagagaagtagaaag
gcacgtgaggaagcacttaatgctgcaaaacatgctggtatggtagaaaatatggcaatg
atggatttgaatgacaattctaaaaatacatcagatttatataaaagagcaaaagatacc
gttatgacccccgaagtaggagaacagacaaagccaaaaccttcaagaaataatgatgtt
ttctgtgttgtttcagagccttcttccgccttggatttagaatttgaatatgagggggag
gatgattcagatagtcaagataacttcggcctagattttgtaccaactgacatagatcca
aatgaccctctaagttcaatgtttgaatatgaggaagaagatccacttttggagagtatt
aagcaaatttcagaggatgtgaacgatgaagtagatgatatttttgacgaaaaggaagaa
tgcttggtagcatttgcaagaatatacagtggcacactaagagttggtcaggagatttcg
gtattgggtccaaaatatgatccaaaatgtccagaggagcatattgaaactgcgattatt
acgcatttatatttgtttatgggtaaggaattggttcctttggacgtttgtccatcagga
aatatagtcggtattcgtggtctggccggtaaagttttaaagagtggtacgttgatagag
aagggcgtacaaggcgtcaatctagcgggcgtcaatttccattttacgccaatcgttcgt
gttgctgtggagccagccaatcctgtggaaatgagcaagttggtacgaggattaaagttg
ttggatcaagcagatccttgcgtgcacacatacgttgaaaatactggtgaacacattctg
tgtacggccggtgaattacatttagaaagatgcctaaaagatttaacagagagatttgca
ggaatagaaattacacattctgaaccggctattccatatagggaaacatttttatcagcc
tcagatatgaatccaccgcagaattcacagctgggaaggggtgttcatgaactactattg
agccagtacaagattacattcagaacgttcccattaagcggtaaagttacagacttttta
tctcaacatcaaaatagcattaaaaacattttgaagacgtccacttcaagcatggatccc
gtcatagaatcaactggaagttcttttctagacaaaaagtctttactcgttgcttttgaa
gaggtcataaatcaggaggagaagagcagagaactattaagtgggtttaaagtaaagtta
gcaggttttgggccaagtagagttgggtgcaacattttgctgtcgcaggataatcttctt
ggaagcctatttgaaggtactccagcagcctttgagtattcagattccatcaaaaatggc
ttccaactggctgttagcgaaggacctctggcaaatgagcccgtacagggaatgtgtgtt
cttgttgaaagcgtacataagatgtcacaagacgaaattgaatctattgaagatccgcgc
taccaacaacatattgtggacttatcagggaggttgataacttctacaagggacgctata
catgaggcctttttagactggtccccaagaattatgtgggcaatttactcatgtgatatt
caaacctctgtcgatgtacttggaaaagtgtatgccgttattctacagaggcatggtaaa
atcatttctgaagaaatgaaagaaggtacaccgttttttcaaattgaggcacatgtgccc
gttgtggaagcattcggtttaagtgaagatattcgtaaacgaacatctggtgcagcacaa
cctcaattggtattttccggattcgagtgtatcgatttagatccattttgggtcccaacc
acagaagaagaattggaggaactaggtgatacagcagatagagagaatattgcccgtaag
catatgaatgccatcagaagaaggaaaggtctattcattgaagaaaaagttgtcgaaaat
gccgaaaaacaacgtactttgaaaaagaattaa

DBGET integrated database retrieval system