KEGG   Saccharomyces cerevisiae (budding yeast): YNL167CHelp
Entry
YNL167C           CDS       T00005                                 

Gene name
SKO1, ACR1
Definition
(RefSeq) Sko1p
  KO
K09051  ATF/CREB family transcription factor
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YNL167C (SKO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YNL167C (SKO1)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    YNL167C (SKO1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: bZIP_1 Aft1_OSA ATP13 bZIP_2
Motif
Other DBs
NCBI-GeneID: 855554
NCBI-ProteinID: NP_014232
SGD: S000005111
UniProt: Q02100
Position
XIV:complement(319416..321359)
Genome map
AA seq 647 aa AA seqDB search
MSSEERSRQPSTVSTFDLEPNPFEQSFASSKKALSLPGTISHPSLPKELSRNNSTSTITQ
HSQRSTHSLNSIPEENGNSTVTDNSNHNDVKKDSPSFLPGQQRPTIISPPILTPGGSKRL
PPLLLSPSILYQANSTTNPSQNSHSVSVSNSNPSAIGVSSTSGSLYPNSSSPSGTSLIRQ
PRNSNVTTSNSGNGFPTNDSQMPGFLLNLSKSGLTPNESNIRTGLTPGILTQSYNYPVLP
SINKNTITGSKNVNKSVTVNGSIENHPHVNIMHPTVNGTPLTPGLSSLLNLPSTGVLANP
VFKSTPTTNTTDGTVNNSISNSNFSPNTSTKAAVKMDNPAEFNAIEHSAHNHKENENLTT
QIENNDQFNNKTRKRKRRMSSTSSTSKASRKNSISRKNSAVTTAPAQKDDVENNKISNNV
TLDENEEQERKRKEFLERNRVAASKFRKRKKEYIKKIENDLQFYESEYDDLTQVIGKLCG
IIPSSSSNSQFNVNVSTPSSSSPPSTSLIALLESSISRSDYSSAMSVLSNMKQLICETNF
YRRGGKNPRDDMDGQEDSFNKDTNVVKSENAGYPSVNSRPIILDKKYSLNSGANISKSNT
TTNNVGNSAQNIINSCYSVTNPLVINANSDTHDTNKHDVLSTLPHNN
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcgaggaacgctcgagacaaccaagtactgtttcaactttcgatttagaaccc
aatccttttgaacaaagcttcgcctcttccaagaaggctttgtcacttccaggcacgatc
tcccatccgtctctaccaaaagagctttcacgaaacaattctacctcaacgataacacaa
cattcccaacgttccactcatagtttgaacagtattccagaagaaaatgggaattcaacc
gttacagataatagtaatcataatgacgtaaaaaaagactcacctagttttttaccaggc
caacaaagacctactataatatctccgcctattctcacacctggtgggtcgaaaagatta
ccacctctactcctttctccctctattttatatcaggcaaattcaactacgaatcccagt
cagaattcacattctgtttcagtctctaattcaaaccctagtgcaataggcgtttcttct
acctccggatctctgtatccaaacagctcttctccttcagggacttcacttatacgccag
ccacgaaactcgaacgtgaccacaagtaattctggtaacggcttccccacgaatgattca
caaatgcctggctttttattaaacttgtccaaatctgggttgacacctaatgagtccaat
atcaggaccgggttgacacccggtattcttacgcaatcttacaattatcccgtattgccg
tcaattaataaaaatactataacaggtagcaaaaatgtcaacaaaagtgtcacagtgaat
ggaagtattgaaaaccaccctcatgttaatataatgcacccaactgtaaatggtacacca
cttacgccgggattgagttctctgctaaacttaccatctactggagttttggctaatcca
gtattcaaatcaacacctacaacaaataccacagatggtaccgtcaacaacagcatcagt
aattccaatttttccccaaatacttcaacgaaagcggctgtcaaaatggataatccggca
gagttcaatgccatcgagcactccgctcataatcacaaggagaatgaaaatttaacgact
caaattgagaacaatgaccagttcaataacaaaacacgaaaaagaaagagaaggatgtct
agcacaagttctacttctaaggcttcaagaaaaaattccatatcaagaaaaaactcagca
gttacgactgcaccagcacaaaaagatgatgttgaaaataataaaatttcaaacaacgta
acacttgatgagaatgaagagcaagaaagaaaaagaaaggagtttttagaaagaaataga
gtagctgcatctaaatttagaaaaagaaagaaagagtacatcaagaaaattgaaaatgat
ctacaattctatgaatctgaatatgacgatctaactcaggtcattgggaagctatgcggc
ataataccctcaagctcctcgaattcccaattcaatgtgaatgtttcaactccgtcatca
tcatcaccaccatctacatctttaatagcattgttagagagtagcatttcaaggagtgat
tattcaagtgcaatgtcagtattatcaaacatgaagcaattgatatgtgaaacgaatttt
taccgaaggggaggcaaaaacccaagggacgacatggatggccaagaagacagcttcaat
aaggacactaacgttgtcaaaagcgaaaatgcgggctatccttccgttaattcaagacca
ataattctagataaaaaatactcactgaactctggagcaaatatcagcaaaagtaacaca
actactaataatgtgggaaatagtgcacagaatataatcaattcatgctactctgttact
aatccattggtaataaatgcaaattccgatacccatgatactaataagcatgatgtacta
tccactctacctcacaataattga

DBGET integrated database retrieval system