KEGG   Saccharomyces cerevisiae (budding yeast): YNL172WHelp
Entry
YNL172W           CDS       T00005                                 

Gene name
APC1
Definition
(RefSeq) anaphase promoting complex subunit 1
  KO
K03348  anaphase-promoting complex subunit 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
sce04120  Ubiquitin mediated proteolysis
Module
sce_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YNL172W (APC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YNL172W (APC1)
   04113 Meiosis - yeast
    YNL172W (APC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YNL172W (APC1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YNL172W (APC1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     YNL172W (APC1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    YNL172W (APC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ANAPC1
Motif
Other DBs
NCBI-GeneID: 855549
NCBI-ProteinID: NP_014227
SGD: S000005116
UniProt: P53886
Position
XIV:310636..315882
Genome map
AA seq 1748 aa AA seqDB search
MTSKPSTRNDYLPRETHNGEYTGDSPEWQLQINITNKIGGINGDIWLSRDGRSVKWCIED
QCLRQFTYNQKIIKAGYIDFEKTPDCFVVVLSDIAHVYMLKNGGSTTVCFPFQIGNAFWY
ANGVILERETSASFMDGGYDLKPIEFDLKHKYITLTDPMAPFGLISITNTFKGGINSASG
NKTDILQDFQLVLFPSDKDKCIAVFLDRNSKVLRFYYSRILSSDQSRKGELTISSTKKTG
LDAAGNSQKSGGISKDLRKFSHLTRRSTSINSNSHDFNAAERVLSGNVGNASGRTDIFAL
PSSCSRRSLSATLDRMGNNIAPTNRAAPSGFFDSSSANTATHSNITPVSQPMQQQQQEYL
NQTATSSKDIVLTEISSLKLPDDIIFTSRRLSSILSKLKFLSLRFERREGLLIFHEPTHF
CKIWLIDLLPDVLDSIPFKIYGNSPQNMIRLENLKLKEPSRIQAMYIHELLESCLILVSE
GQNKEEYKACLYDPFVKITSPSKNISEELTKQNSLPSLQKLFPYPETSFTKLCFEAVKYI
TSPAFNISFIFLWQSAYSILLSRANDDVVGGLKMEHDAFSLVLSLLILPIPSSSAQEYQE
YKEIYERDLFQHLKQDSEITSSVLPRIVIGLHLIREEYSLNVLCRNEHALLGQFLRFATA
AMGWPDLWQSYYVPKMDSESKTFLHPREQNSTFFHPLDEPPSITKSLYSITENSSIPLCP
FISFSRLVATDTQVELRITPRSFKILGLYELVHSPNFLPDYVLGILSSFKVDKDELQTYP
LGILVPLQNILKILEDKLSEVRDNLELLDRADLQRCSAIINSIRSDSKEVLKRGQRDSYM
LCKVPLAKNRSSLSKKPSDIYSILSEIVKSASQVPLDGSAMRMSNIQDDEDIDEGRSLKL
NAGLIFSEDKRFTHVVSLLAYYRPTKTQFFTTKTEYAQILAQKKYFAKIMALRTCTNGVG
WGAVAYATEKPISTQKWVIQPLNLISVFPDDTKITVKAPEDIAHDIVEWGQFHAGVSSGL
RISKKATGITGSWIAFNKPKELDAYHGGFLLGLGLNGHLKNLEEWHIYNYLSPRNTHISI
GLLLGMSSSMKGSMDSKLIKVISVHLVAFLPSGSSDLNIDLKLQTAGIIGMGMLYLNSRH
KRMSDSIFAQLVSLLNVNDEMVADEEYRLAAGISLGLINLGAGQTKLRKWDSSLLGLGDD
LPEDVYDSSDVEQNVMYEDLTTKLLEIVTSTYDVENDWIPENSQIGAVIAIMFLFLKSNN
FGISNMLKVDLKEILKANINTRPELLMYREWASNMILWEFIGDDLSFIMKDVDIGVKFSE
LNTDLLPIYYTMAGRILAMGIRFASTGNLKIRNILLSLVDKFLPLYQYPGKQNLDFRLTI
SVINVLTNVIVVSLSMVMCASGDLEVLRRVKYLHEVASGPYSDLFQEIPSSKSDVSGVTQ
VTSNTNTPGNSDRERVDETAASLDDERSSNGSDISDPTAYLEDKKDIDDHYGKFISTNLA
LGFLFLGSGQYALNTSTLESIAFLSMSVLPTYTTPHPLQELKHFWSMAVEPRCLVIKDIS
TGDAVNNVPIELVVEEDVEKEEVIREISTPCLLPDFSKIKSIRVKMHGYFPLEVNFTKDY
SASDFFSGGTIIYIQRKSESVFENKASFRNVEDIHVALKRKAAESKNYSRLNLKNEQGNT
TSSQLVESLGIQDLTMVELDTLLSAGNNTALTDSESYNLGLLCSDKNSGDILDCQLELWY
KSFGPHDE
NT seq 5247 nt NT seq  +upstreamnt  +downstreamnt
atgacttctaagccgtctactagaaatgattatttaccaagggaaactcacaatggcgaa
tatactggtgattctcccgaatggcagttgcagattaatatcacaaacaaaataggtggt
ataaatggagatatttggttgtcaagggacggaaggagtgttaaatggtgtattgaagac
cagtgcttacgtcagtttacttataatcaaaagatcatcaaagctgggtacattgatttt
gaaaagacaccagattgttttgtggtagttctctctgatattgcgcatgtatatatgttg
aaaaatgggggttctacgactgtatgtttcccattccagataggtaatgcattctggtat
gcaaatggagtaattttagagagagagacttcagcgtccttcatggatggtggctacgat
ttaaaacccattgagttcgatttaaaacataaatacatcactttgacggatccgatggcg
cctttcggcttgatttcgatcacaaatacctttaaaggcggtataaatagcgcttcaggt
aacaaaacggatatcctgcaagactttcagctcgtgctcttcccgagtgacaaggacaag
tgtatagctgtttttttagatcgaaattccaaagtgttgcgattttattacagtagaatt
ctatcatcagatcagtcacggaagggagagctaacaatttcctcgaccaaaaaaacaggt
ttggacgcagcaggcaatagccaaaagagtggcgggattagcaaagatttgcgtaagttt
tcacatttgacgcgccggtcgacgtctataaactctaactctcatgatttcaatgcagcc
gaaagagtacttagtggcaatgttggcaacgcttcaggcagaacagatattttcgcttta
ccttcttcttgttcaagaaggagcttatctgcgaccctagatagaatggggaacaatatt
gccccgaccaatagagctgcaccttctggattttttgactcgtcatcagcaaatactgct
actcactctaatataacgcctgtatcacaaccaatgcaacagcaacagcaagaatatttg
aaccaaacagcgacctcttctaaggatattgttttgacggaaatatcgtctttgaaatta
ccggatgatatcatttttacttcacgacgcttgagctctattttaagtaaattaaagttc
ctatcgttgagatttgaacgtcgagaaggacttttaatatttcatgagcccacacatttc
tgcaaaatctggttgattgatcttttacccgatgttctggattctattccattcaaaata
tacgggaactctccgcaaaacatgatcagactagagaacttaaagcttaaggaaccctca
agaatacaagctatgtatattcatgaactccttgaaagttgcctgattttggtgtcggag
ggacagaataaggaagaatacaaagcatgtctatatgaccccttcgttaaaattacatcc
ccttccaaaaatatctccgaagagctcactaaacaaaattctcttccttccttacagaaa
ctattcccttatcccgagactagtttcaccaaactgtgcttcgaagccgtcaagtatatt
acttctcctgcattcaatatttcatttatatttctatggcaatctgcatattcgatactt
ctttcaagggctaacgacgacgtagttgggggtttgaaaatggagcacgatgctttttca
ctggttctttcattgctgattttaccgatacctagctcctctgctcaagaataccaggag
tacaaagaaatatatgaacgcgacctgtttcagcatttaaagcaggactcagaaataaca
agctctgtgctaccaagaattgttattggattgcatttaataagggaggaatattccctg
aatgtattgtgtcgaaatgagcatgcgttgttaggacagtttctaagattcgctactgcc
gcgatgggctggcctgatctgtggcaatcttactatgtaccgaaaatggattcagaatcg
aaaactttcctacatccaagggaacaaaattccactttttttcatcccttagatgaaccg
ccatcgattaccaagtcgttatacagcataactgaaaacagttcaataccattatgtccg
ttcattagtttctcgagacttgttgcaaccgatacacaggtcgaattacgcattactcca
agaagtttcaaaatcttgggcttgtatgaactcgtacactctccaaattttttaccggat
tatgttttaggcatcctttccagctttaaagtggataaagacgagttacaaacatatccc
ttaggcattttggtgcctttacaaaacattttaaaaattctggaagataagctatctgaa
gtaagagacaacttggagttattagatagggccgatttacaaaggtgtagtgccattatc
aatagtataagaagtgattctaaagaagttctcaaaagaggccaaagagatagttatatg
ttatgcaaagtgccactcgccaagaacagaagctctttgtctaagaagcccagtgacata
tattcaatattatccgagattgtgaaaagtgcaagtcaagttccactggatggatcagct
atgaggatgtcgaatattcaggatgatgaagatattgatgaaggtcgatctctcaaatta
aatgcaggactgattttttcagaagataaaagatttactcatgttgtatcactattagct
tattacaggcccacaaaaactcaattttttaccaccaagacagaatatgcccagatacta
gctcaaaagaaatatttcgctaaaatcatggctttgaggacatgtacaaatggtgttggc
tggggtgcagtggcatatgcaacagaaaaaccaatatctacccaaaaatgggtcattcaa
cccctcaacttaatttccgtgtttcctgatgacacaaagataactgtgaaagctccagaa
gatatagcacacgatattgtggagtgggggcaatttcatgccggtgttagctccggcctc
cgtatctcaaagaaggcaactggaattacaggtagttggattgcatttaataagccaaaa
gaactagatgcttatcacggtggtttccttctcggactgggacttaatgggcatttgaag
aatttagaggaatggcatatatacaattatctaagccccagaaatactcacataagtatt
gggttacttttgggaatgagttcaagtatgaaaggtagtatggactctaaactaatcaaa
gttattagtgtacacctagtggcctttcttccaagcggatctagcgatttgaatatagat
ctaaaactacaaactgctggtattatagggatgggtatgttatatttaaactcaaggcat
aaacgaatgagcgattcaatttttgcccagctggtgtcactgctcaatgtaaatgatgaa
atggttgctgacgaagaatatcgattagcagcgggtatatcgctgggcctcataaaccta
ggggctggtcagacgaaactgagaaagtgggattcatcattgttgggcttgggggacgat
cttccggaagatgtttatgactctagtgatgttgaacaaaatgtaatgtatgaagacctg
actacgaagttattagagatcgtcacaagcacatatgatgtagaaaacgattggatacca
gagaattcgcaaattggcgcagtaattgcaatcatgtttttatttttgaagtcaaacaat
tttggaatttccaacatgcttaaagttgacttaaaggaaatattaaaagcaaatattaac
acccgccctgaattattaatgtaccgagaatgggcatccaatatgattttatgggaattt
ataggcgacgacctatcgttcatcatgaaagatgttgatattggagtaaaatttagtgaa
cttaataccgatttgcttcctatatattacactatggcgggtaggatcttagccatgggt
attagatttgcctctactggaaatttgaaaattcggaatatactgctttctctcgttgat
aagtttctgcctctttatcagtacccaggaaagcagaatctagactttaggttgacaatt
tctgttattaacgttttaactaatgtcatcgttgtttctttgagcatggttatgtgtgcc
agtggcgatttagaagttttgaggagggtcaaatatcttcatgaagttgcatctggtcca
tattcagacttatttcaagaaattcctagttctaaaagtgatgtttcaggtgtaacacag
gtgacttcaaacactaacacgcctggaaatagtgatcgtgaaagggttgatgagaccgct
gcttctctcgatgacgaaaggtcctcaaatggcagtgatattagtgatccaacagcatat
ctagaagacaaaaaggatatagatgaccattacggtaagtttatttcgacaaatcttgca
ctgggttttcttttccttgggtctggacaatacgctctcaatacttctactttagaatct
atcgctttcttaagcatgtccgttttacccacatatacaactccacatcccttacaagaa
ttgaagcatttctggagcatggctgtagagcctcgttgccttgttataaaggacatttcc
actggtgacgcagtaaacaacgttcctattgaattggtggtcgaggaagacgtcgaaaaa
gaagaagtaataagagagatatcaacaccttgcctgcttcctgatttctccaaaattaaa
tctattagggtaaaaatgcatggttactttccactggaagtaaatttcactaaggactac
tcagcttctgatttttttagtggcggtacaattatttatatacaaagaaaatccgaaagt
gttttcgagaacaaagcctcttttaggaacgtagaagatattcatgtggcactcaaaaga
aaggcagcagaatctaaaaattattcaagattaaacctaaaaaatgaacaaggaaatacc
acctcttcgcaactggttgaaagtttgggtattcaagatttgacaatggtggaactcgat
actcttttgagtgcaggaaataatacagcattaacggattcagaatcttataatttaggt
ttgctgtgttcagataaaaacagtggagatattttggattgccaactcgaattgtggtac
aaaagctttggaccacatgatgaataa

DBGET integrated database retrieval system