KEGG   Saccharomyces cerevisiae (budding yeast): YNL173CHelp
Entry
YNL173C           CDS       T00005                                 

Gene name
MDG1
Definition
(RefSeq) Mdg1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMPK1_CBM
Motif
Other DBs
NCBI-GeneID: 855548
NCBI-ProteinID: NP_014226
SGD: S000005117
UniProt: P53885
Position
XIV:complement(308957..310057)
Genome map
AA seq 366 aa AA seqDB search
MQSSLPQFTFKWPKGPEAIILTGTFDDWKGTLPMVKDPSGAFEITLPVTFDSPSSKFYFK
FIVDGQWLPSKDYKVNIDEGVENNFITEEDVIKQRENGSSTLVPESAGLAVSKNAPLIEP
EAEKRAKKLRKFKIKRVIKTNKQTGERSIFSQEVVELPDSEDETQQVNKTGKNADGLSGT
TTIIENNVGVNEEKAIKPYEENHPKVNLVKSEGYVTDGLGKTQSSESRLYELSAEDLEKE
EEEEDEDKGGGKDTSTSADAEASEDQNKEPLSKSAKFEKPEEKVPVSSITSHAKETSVKP
TGKVATETQTYETKQGAPTAAAKKIEAKKATRPSKPKGTKETPNKGVQKNPAKNGGFFKK
LAQLLK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcgagcttacctcaatttacgttcaaatggcccaaaggacccgaagcaattatt
ctgacaggcacgttcgacgactggaaaggtactttgccgatggtgaaggaccccagtggc
gccttcgaaataacgctgccagtaacgtttgatagccctagcagcaagttttatttcaag
tttattgttgatggccaatggctgccaagcaaagactacaaggtgaacatcgacgaggga
gtggaaaacaactttattaccgaggaagacgtaataaagcaacgcgaaaatggctctagc
acgctggtacctgaaagtgccggattagctgtttcaaagaatgcccctcttatcgaacca
gaagctgaaaaacgtgcaaaaaaattaagaaagttcaagatcaagagagtgatcaagaca
aataaacaaaccggagaaaggtcgatattttcccaagaagtggttgaattgcccgatagc
gaggatgaaacccagcaggtgaacaaaacgggcaagaatgcggatggcttaagcggtact
acaacgataattgagaataatgttggtgtaaacgaggaaaaagcaatcaagccgtatgaa
gagaatcaccccaaagttaatctagttaagagtgaaggatatgttacggacggtttgggt
aagacgcaatcttctgagtctagattatatgaactatcggccgaagatcttgaaaaggaa
gaagaggaagaggacgaagataaaggcggcggtaaggacaccagtacaagtgcagacgct
gaagcttcagaagatcaaaataaggaaccattaagtaaatccgctaaatttgaaaaaccg
gaagaaaaagtacctgtaagctcaattacaagccatgctaaagagacttctgtgaaacca
accggcaaggttgcgactgagactcaaacttacgagacgaaacagggcgctcctaccgct
gccgcaaaaaaaatcgaagctaagaaagctactagaccttcgaaacctaagggcacgaaa
gaaacaccaaataaaggtgtccaaaagaaccctgctaagaatggagggttctttaaaaag
ttggcccagcttttgaagtga

DBGET integrated database retrieval system